KEGG   Corynebacterium resistens: CRES_0357Help
Entry
CRES_0357         CDS       T01538                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
crd  Corynebacterium resistens
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:crd00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:crd00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(415915..416598)
Genome map
AA seq 227 aa AA seqDB search
MTSQISPSEPVFDRPTGFAKGDYPEVTETSIAEALQRRGLRRKDVVIGMIWAQTTDGIIG
DGKDMPWYLPEDLQHFKNSTVGHAVVMGRTSWEALGDRYRPLPERENYVVTRNSSYEAPG
GHVFTSLSDAIASATAFQLQNNESRPALVWILGGGQVYAQCMPVADRIVITEIKMTAPDR
FQVYAPLVEAPEFTLNASQWKTSEKGHTVDGEGELQYRICEWTRRAV
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgcagatttccccttccgaaccagtttttgaccgtcccacgggtttcgctaag
ggtgactatccagaggtcactgaaacctcgatcgccgaagcattgcagcgccggggattg
cgccgcaaagacgtagtaatcggcatgatctgggcgcaaaccaccgacggaataatcggc
gatggcaaggatatgccgtggtatctgccggaggatctgcagcacttcaaaaactccacg
gtgggccacgctgttgtcatgggacgcacctcatgggaggctcttggcgaccgctaccgc
ccgctgcccgagcgcgaaaactacgttgtcacccgcaactcttcgtacgaggctccgggt
ggtcacgtcttcacttctttatccgacgccattgcatccgccaccgcttttcagcttcaa
aacaacgaatcgcggccggcgctggtatggatcctcggcggcgggcaagtctacgcccag
tgcatgccggtggccgatcgaatcgtcatcactgaaattaagatgactgctcccgatcgt
ttccaggtgtatgccccgctagtggaagcacccgaattcaccctgaacgccagccagtgg
aagacctctgaaaagggccacaccgtcgatggcgaaggcgaactgcaataccgaatttgt
gaatggacacgcagggcggtgtag

DBGET integrated database retrieval system