KEGG   Corynebacterium resistens: CRES_0471Help
Entry
CRES_0471         CDS       T01538                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
crd  Corynebacterium resistens
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:crd00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:crd00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:crd02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
563348..564982
Genome map
AA seq 544 aa AA seqDB search
MNTPAERAQEKAQRQLSRRGFLTVSGLTVATAAGAGLAGRAAAQAQSALGSSFGSSMGSS
SGVPLIPKRPVISHGVASGEMTSSGAVIWTRADRPARMVVEAATNGRFKNAKVFRAPAPL
TPATDGTGRVRLSGLPAGRDIHYRVFLEDMYTGLRSQPTMGTFRTAPVTARDIRFHWSGD
VAGQGYGINPKIGGMRGWATMAKRNPHFFLHSGDVIYADGPIEEKVKLEDGRIWHNLTSE
ETAKVAETLKEFRGRYAYNLRDENYKNFNAHVPQLVQWDDHETTNNWYPGEILTDDKYTE
KRVDVLSARSIRAFHEWQPVDRKVAVDGRIYRKVSYGPLLDVFILDMRSYKDSNAKHTKD
NTKAGWILGDKQRKWLIDGVKNSKATWKIIANDLPIGIVVPDGDKAQESVSSGTPGKPVG
REQEIATVLSAIKNVKNVVWLTADVHYCAAHEYHPDRAAFQDFSPFWEFVSGPLNAGAFG
PNDMDSTFGPEVVFSHTPDQPNRSPLDDYQHFGEVDINGRSRELTVRLISTQGKVLYTKT
LPAN
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaccccagccgaacgagcccaagaaaaagcgcaacggcagttatcccgtcgtggt
tttctcaccgtttcaggattgactgtcgcgacagcggcgggggcggggctagcaggccga
gccgccgcacaagcgcagtctgcgctcggtagttctttcggctcatctatgggaagttcc
tccggggtgcccctcattccgaagcggcctgtgattagccacggcgtggcgtctggcgaa
atgacaagcagtggtgccgtgatctggacccgggccgaccgacccgcacgaatggtggtg
gaagcagcaacgaacggccggttcaagaatgcgaaggtgttccgggccccggcgccattg
accccagcgacggacggcacgggacgggtaaggctttccgggctgccggcggggcgcgat
atccactaccgcgtgttcttagaggacatgtacaccgggttgcgttcccagccgacgatg
ggaacattccggacggcgccggtgactgcgcgtgatattcgcttccactggtcaggcgat
gtggccggccaaggctatggcatcaacccgaaaatcggcggtatgcgcggatgggccacg
atggctaagcgcaatccacacttcttcctgcactcgggtgatgtgatttacgccgatggt
cctatcgaggaaaaggtaaagctagaagacggtcgcatttggcacaacctgaccagcgaa
gaaactgccaaggtagcggaaaccctgaaggaattccgcgggcgctacgcgtacaacctg
cgtgacgagaactacaagaatttcaacgcgcatgtgccgcagctggtgcagtgggatgac
cacgagaccaccaataactggtacccgggcgagatcctgaccgatgacaagtacaccgaa
aagcgtgtggatgtgctttcggcgcgttccattcgagcattccacgaatggcagccggtg
gatcgcaaggtcgcggtggatgggcgcatttaccgcaaggtttcctacggcccgctgttg
gacgtgttcattttggatatgcgtagctacaaggattccaacgcgaagcatacgaaggac
aacacgaaggcaggctggatcttgggcgacaagcagcgcaagtggctgatcgatggggtg
aagaactccaaggcgacatggaaaatcatcgccaatgacctgccgatcggtatcgtcgtc
cccgatggcgataaggctcaagaaagtgtttcttctggcactccgggcaagccagtgggc
cgggaacaggagatcgccacggtgctttcggcgatcaagaatgtgaagaacgtggtgtgg
ctaaccgcggacgtgcactattgtgccgcacacgaataccacccggatcgggcggcgttc
caggatttctccccattctgggagttcgtttccggacccttgaacgccggcgcgttcggc
ccgaatgacatggactccacctttgggccggaggtcgtgttctcccacactccggaccag
ccgaaccgctccccactggatgattaccagcacttcggcgaggtggatattaacggccgc
tcccgcgagctgaccgtgcgtttgatcagcacccagggcaaggtgctgtacacgaagacc
ttgcccgcgaattag

DBGET integrated database retrieval system