KEGG   Corynebacterium resistens: CRES_0562Help
Entry
CRES_0562         CDS       T01538                                 

Gene name
fadB1
Definition
(GenBank) enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
crd  Corynebacterium resistens
Pathway
crd00071  Fatty acid degradation
crd00280  Valine, leucine and isoleucine degradation
crd00281  Geraniol degradation
crd00310  Lysine degradation
crd00362  Benzoate degradation
crd00380  Tryptophan metabolism
crd00410  beta-Alanine metabolism
crd00640  Propanoate metabolism
crd00650  Butanoate metabolism
crd00903  Limonene and pinene degradation
crd00930  Caprolactam degradation
crd01040  Biosynthesis of unsaturated fatty acids
crd01100  Metabolic pathways
crd01110  Biosynthesis of secondary metabolites
crd01120  Microbial metabolism in diverse environments
crd01130  Biosynthesis of antibiotics
crd01200  Carbon metabolism
crd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CRES_0562 (fadB1)
   00650 Butanoate metabolism
    CRES_0562 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    CRES_0562 (fadB1)
   01040 Biosynthesis of unsaturated fatty acids
    CRES_0562 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CRES_0562 (fadB1)
   00310 Lysine degradation
    CRES_0562 (fadB1)
   00380 Tryptophan metabolism
    CRES_0562 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CRES_0562 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CRES_0562 (fadB1)
   00281 Geraniol degradation
    CRES_0562 (fadB1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CRES_0562 (fadB1)
   00930 Caprolactam degradation
    CRES_0562 (fadB1)
Enzymes [BR:crd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CRES_0562 (fadB1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CRES_0562 (fadB1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CRES_0562 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH Peptidase_S49 NAD_binding_2 2-Hacid_dh_C NAD_binding_8 adh_short_C2 UDPG_MGDP_dh_N F420_oxidored DUF4034
Motif
Other DBs
NCBI-ProteinID: AEI08924
UniProt: F8DYT2
Position
complement(686898..689243)
Genome map
AA seq 781 aa AA seqDB search
MSNNMFTWETDADGILTLTMDDPNAPVNTMNQTFQDDLIETVAKVKEAVEAGEVKGIVLA
SAKKTFFAGGDIKSMIKATPEDAPALTKQIDTMKDNLRTLETLGVPVAAAINGTALGGGL
EIALAAHHRIASDAKGLKVGLPEVTLGLLPGGGGVTRVVRMLGLQDALMKVLTTGRQFNA
ADAQKTGLIDEIVPADQLLDAAKKWVKENPEAKQPWDTEGYKVPGGTPTNPKLAAFLPSF
PANVTKQIKGAPMPAPKAILKAAVEGLQLKNIEEATRVETRYFVELVTGSTSKNMMQAFF
FDLQYCNGGGQRPKDVEKKQFKKLGMVGAGMMGAAIAYVAAKAGMDVVLKDIKMEAAEKG
KSYSEGLEAKALKRGKTTEEKSKALLDRIKPSVDYSDLSDCDIVIEAVFENTELKHKVWA
EIEAAVPEDCVLGSNTSTLPITELATGVKRPKDFIGIHFFSPVDKMPLVEIIKGEETSDA
TLAAALDFTGQIRKTPIVVNDSRGFYTSRVIGFFLNEAMRMLAEGVDPAVIEAAGRQAGY
PAPPLQLQDELNLKLARKIGSETRAAQEAAGLSVDDGGVTEIVDKMLDVYDRPGKLEGKG
FYEYNEEGRRAGLWRGLWDELGAGKVKVADAESTLSGEGLNGATEGAARKASGFGQLEGT
EKAAGSDVPADAPAFIDLVERMLFAEAIETQKCLDEGVLTSDADANIGSIMGIGFPAWTG
GTRQYIKNYARPASAVLPEGKTADRNGGDYPTTGVAGFVARAEELAAKYGERFEVPESLK
Q
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaacatgttcacgtgggagacggacgctgacggcatcctcaccctgaccatg
gatgacccaaatgcgccggtgaacaccatgaatcagaccttccaggacgacctgattgag
acggtcgcgaaggtcaaggaagccgtggaggccggcgaggtcaagggcatcgtgctggct
tcagcgaagaagaccttcttcgctggcggcgacatcaagtccatgatcaaggccacccca
gaggatgcgccggcgctaaccaagcagatcgacacaatgaaggacaacctgcgcaccctt
gagaccctgggtgtgccagtggctgcagccatcaacggcaccgcgctgggtggcggtttg
gagatcgcattggctgcccaccaccgcatcgcttccgatgccaagggcctgaaagtcggc
ctaccggaggtcaccctcggcctgctgcctggcggtggcggcgtgacccgtgttgtccgc
atgctgggtctgcaggatgcgctgatgaaggtgctgaccactggccgtcagttcaatgca
gctgacgcgcaaaagaccggcctgatcgacgagatcgtgccagccgatcagctgctcgac
gccgctaagaagtgggtcaaggagaacccagaggccaagcagccatgggataccgaaggc
tacaaggtccccggtggcaccccaaccaacccgaagctggccgcgttcctgccttctttc
cctgcgaacgtaaccaagcagatcaagggcgctccgatgcccgctccaaaggcgatcctc
aaggctgcggttgaaggtctgcagctgaagaacatcgaggaagccactcgtgtagagacg
cgctacttcgtggagctggtaaccggttcgacctcgaagaacatgatgcaagccttcttc
ttcgatctgcagtactgcaacggtggtggtcagcgcccgaaggacgttgagaagaagcag
ttcaagaaactgggcatggtcggtgccggcatgatgggtgccgccattgcatacgtagct
gccaaggctggcatggatgttgtgctgaaggacatcaagatggaggcagcggagaagggt
aagtcctactccgagggtctcgaggccaaggcgctgaagcgcggcaagacgaccgaagag
aagtccaaggctctgctggatcgcatcaagccatccgtcgactactctgacctgtccgat
tgtgacattgtcatcgaggccgtgttcgagaacaccgagctgaagcacaaggtctgggct
gagatcgaggctgctgtgccagaggattgtgtgctgggatccaacacctccaccctgcct
atcaccgagctggctaccggtgtgaagcgcccgaaggacttcatcggcattcacttcttc
tccccagtggacaagatgccactggtggagatcatcaagggtgaagagacctccgatgcg
accttggctgcggctctggacttcactggtcagatccgcaagacccctatcgtggtcaac
gattcccgcggtttctacacctcccgcgtgattggattcttcctcaacgaggctatgcgc
atgcttgctgagggcgtggatccagctgtcatcgaggctgctggccgccaggccggttac
cccgcgccaccgctgcagttgcaggatgagctgaacctgaagttggctcgtaagattggt
tccgagacccgcgctgcccaggaggctgcgggcttgtccgtggacgatggcggggtaacc
gagatcgtcgacaagatgctggacgtttacgatcgtcccggcaagctcgagggcaagggc
ttctacgaatacaacgaggaaggccgtcgcgctggcttgtggcgcggcctgtgggatgag
ctgggcgccggaaaggtcaaggttgccgatgctgaatccactctgtccggcgaggggctg
aatggcgctaccgaaggtgcagcccgtaaggctagcggcttcgggcagctcgaaggcacc
gaaaaggctgccggttccgatgtacctgcagatgcaccggccttcatcgacttggtcgag
cgcatgctgttcgccgaggctattgaaacccagaagtgcctcgacgagggcgttctgacc
tccgatgcggatgccaacatcggctccatcatgggcatcggcttccctgcatggaccggt
ggtacccgccagtacatcaagaactacgcccgcccggcatcggcagttctgccagaaggc
aagaccgcggatcgcaatggtggcgactacccaaccactggcgtggctggtttcgttgcg
cgcgctgaggagttggcagcgaagtacggcgagcgcttcgaggttccggaatccttgaaa
cagtag

DBGET integrated database retrieval system