KEGG   Corynebacterium resistens: CRES_0562Help
Entry
CRES_0562         CDS       T01538                                 

Gene name
fadB1
Definition
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase (EC:5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
crd  Corynebacterium resistens
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CRES_0562 (fadB1)
   01212 Fatty acid metabolism
    CRES_0562 (fadB1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CRES_0562 (fadB1)
   00650 Butanoate metabolism
    CRES_0562 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    CRES_0562 (fadB1)
   01040 Biosynthesis of unsaturated fatty acids
    CRES_0562 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CRES_0562 (fadB1)
   00310 Lysine degradation
    CRES_0562 (fadB1)
   00380 Tryptophan metabolism
    CRES_0562 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CRES_0562 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CRES_0562 (fadB1)
   00281 Geraniol degradation
    CRES_0562 (fadB1)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    CRES_0562 (fadB1)
Enzymes [BR:crd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CRES_0562 (fadB1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CRES_0562 (fadB1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CRES_0562 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(686898..689243)
Genome map
AA seq 781 aa AA seqDB search
MSNNMFTWETDADGILTLTMDDPNAPVNTMNQTFQDDLIETVAKVKEAVEAGEVKGIVLA
SAKKTFFAGGDIKSMIKATPEDAPALTKQIDTMKDNLRTLETLGVPVAAAINGTALGGGL
EIALAAHHRIASDAKGLKVGLPEVTLGLLPGGGGVTRVVRMLGLQDALMKVLTTGRQFNA
ADAQKTGLIDEIVPADQLLDAAKKWVKENPEAKQPWDTEGYKVPGGTPTNPKLAAFLPSF
PANVTKQIKGAPMPAPKAILKAAVEGLQLKNIEEATRVETRYFVELVTGSTSKNMMQAFF
FDLQYCNGGGQRPKDVEKKQFKKLGMVGAGMMGAAIAYVAAKAGMDVVLKDIKMEAAEKG
KSYSEGLEAKALKRGKTTEEKSKALLDRIKPSVDYSDLSDCDIVIEAVFENTELKHKVWA
EIEAAVPEDCVLGSNTSTLPITELATGVKRPKDFIGIHFFSPVDKMPLVEIIKGEETSDA
TLAAALDFTGQIRKTPIVVNDSRGFYTSRVIGFFLNEAMRMLAEGVDPAVIEAAGRQAGY
PAPPLQLQDELNLKLARKIGSETRAAQEAAGLSVDDGGVTEIVDKMLDVYDRPGKLEGKG
FYEYNEEGRRAGLWRGLWDELGAGKVKVADAESTLSGEGLNGATEGAARKASGFGQLEGT
EKAAGSDVPADAPAFIDLVERMLFAEAIETQKCLDEGVLTSDADANIGSIMGIGFPAWTG
GTRQYIKNYARPASAVLPEGKTADRNGGDYPTTGVAGFVARAEELAAKYGERFEVPESLK
Q
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaacatgttcacgtgggagacggacgctgacggcatcctcaccctgaccatg
gatgacccaaatgcgccggtgaacaccatgaatcagaccttccaggacgacctgattgag
acggtcgcgaaggtcaaggaagccgtggaggccggcgaggtcaagggcatcgtgctggct
tcagcgaagaagaccttcttcgctggcggcgacatcaagtccatgatcaaggccacccca
gaggatgcgccggcgctaaccaagcagatcgacacaatgaaggacaacctgcgcaccctt
gagaccctgggtgtgccagtggctgcagccatcaacggcaccgcgctgggtggcggtttg
gagatcgcattggctgcccaccaccgcatcgcttccgatgccaagggcctgaaagtcggc
ctaccggaggtcaccctcggcctgctgcctggcggtggcggcgtgacccgtgttgtccgc
atgctgggtctgcaggatgcgctgatgaaggtgctgaccactggccgtcagttcaatgca
gctgacgcgcaaaagaccggcctgatcgacgagatcgtgccagccgatcagctgctcgac
gccgctaagaagtgggtcaaggagaacccagaggccaagcagccatgggataccgaaggc
tacaaggtccccggtggcaccccaaccaacccgaagctggccgcgttcctgccttctttc
cctgcgaacgtaaccaagcagatcaagggcgctccgatgcccgctccaaaggcgatcctc
aaggctgcggttgaaggtctgcagctgaagaacatcgaggaagccactcgtgtagagacg
cgctacttcgtggagctggtaaccggttcgacctcgaagaacatgatgcaagccttcttc
ttcgatctgcagtactgcaacggtggtggtcagcgcccgaaggacgttgagaagaagcag
ttcaagaaactgggcatggtcggtgccggcatgatgggtgccgccattgcatacgtagct
gccaaggctggcatggatgttgtgctgaaggacatcaagatggaggcagcggagaagggt
aagtcctactccgagggtctcgaggccaaggcgctgaagcgcggcaagacgaccgaagag
aagtccaaggctctgctggatcgcatcaagccatccgtcgactactctgacctgtccgat
tgtgacattgtcatcgaggccgtgttcgagaacaccgagctgaagcacaaggtctgggct
gagatcgaggctgctgtgccagaggattgtgtgctgggatccaacacctccaccctgcct
atcaccgagctggctaccggtgtgaagcgcccgaaggacttcatcggcattcacttcttc
tccccagtggacaagatgccactggtggagatcatcaagggtgaagagacctccgatgcg
accttggctgcggctctggacttcactggtcagatccgcaagacccctatcgtggtcaac
gattcccgcggtttctacacctcccgcgtgattggattcttcctcaacgaggctatgcgc
atgcttgctgagggcgtggatccagctgtcatcgaggctgctggccgccaggccggttac
cccgcgccaccgctgcagttgcaggatgagctgaacctgaagttggctcgtaagattggt
tccgagacccgcgctgcccaggaggctgcgggcttgtccgtggacgatggcggggtaacc
gagatcgtcgacaagatgctggacgtttacgatcgtcccggcaagctcgagggcaagggc
ttctacgaatacaacgaggaaggccgtcgcgctggcttgtggcgcggcctgtgggatgag
ctgggcgccggaaaggtcaaggttgccgatgctgaatccactctgtccggcgaggggctg
aatggcgctaccgaaggtgcagcccgtaaggctagcggcttcgggcagctcgaaggcacc
gaaaaggctgccggttccgatgtacctgcagatgcaccggccttcatcgacttggtcgag
cgcatgctgttcgccgaggctattgaaacccagaagtgcctcgacgagggcgttctgacc
tccgatgcggatgccaacatcggctccatcatgggcatcggcttccctgcatggaccggt
ggtacccgccagtacatcaagaactacgcccgcccggcatcggcagttctgccagaaggc
aagaccgcggatcgcaatggtggcgactacccaaccactggcgtggctggtttcgttgcg
cgcgctgaggagttggcagcgaagtacggcgagcgcttcgaggttccggaatccttgaaa
cagtag

DBGET integrated database retrieval system