KEGG   Corynebacterium resistens: CRES_0573Help
Entry
CRES_0573         CDS       T01538                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
crd  Corynebacterium resistens
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CRES_0573
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CRES_0573
Enzymes [BR:crd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CRES_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
702460..703695
Genome map
AA seq 411 aa AA seqDB search
MRRILVAISASALLLAGCSTDSGPTPPAHDSTPAETSPSAAATSGGSDSSKAPSQDGRSG
KSSPVQPVKLKCESLSKATDQQLAGRLLAVGVTDFASAQQAVDAGVRHLFIGTGSDYSML
NGQGDPQRSIAALEKRAGEKLTVSVDEEGGEVQRLSKVIGELPSPRKMAATMRPEQVRHM
MAEHGRKLRKLGVTVDFAPVVDLGGAEDISANGIGSRAFSADPQVVAKYGRAYAEGLRDA
GITPVFKHFPGHGHAKGDSHLGTVVTSPLDVMKKQDLVPFKQLSGMDGNTGRDGNTGRPA
VAMMVGHVQVPGLGENKPSSINPVAYKLLRDYNFHGLIVTDDLTGMKAVSDHLTGPEAVV
AAVRAGADQALAAAGGIDVPAAVDGLARAISSGKIPRERAIASADRGCLPS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgaatccttgttgctatttctgcatctgcgttgctgttggctggttgttccacc
gattctgggccgacgccgccagcccacgattccacgccagccgaaacttcgccgtccgct
gcggcgaccagcgggggttctgattcttcgaaggcaccatcgcaggacggccgatcgggc
aagagcagcccggtgcaaccggtgaagctgaagtgcgaaagtttgagtaaagctaccgat
cagcagctggcgggccggcttttggcagtgggagtgacggatttcgcgagcgcccagcag
gcggtggatgccggggtgcgccacctatttatcggaactggcagtgactattcgatgctc
aatgggcagggtgatcctcagcgaagcattgctgctttggaaaagcgggcgggtgagaag
ctcaccgtcagtgtggatgaggaaggcggcgaggtgcagcgcctcagcaaggtgattggt
gaactgcccagcccgcggaagatggccgcaacgatgcgcccagaacaggtgcgccacatg
atggctgaacatggccggaagctgcgcaaactcggtgtgacggtggatttcgcgccggtg
gtggacctaggtggggcagaagacatcagtgccaacggcattggatcgcgcgcgtttagt
gcagatccccaggtagtcgctaaatatggtcgcgcttatgcagagggcttgcgcgatgca
ggtattaccccagtgttcaaacacttcccggggcacgggcatgcgaagggggattcacac
ctcggcacggtggtgacatcacctttggatgtgatgaaaaagcaggaccttgtgcccttc
aaacagctttccgggatggatggtaataccgggagggatggtaatactggccggccagca
gtagcgatgatggttggccacgtgcaggttccggggcttggggaaaataagccatcctca
atcaatccggtggcgtacaaactgctgcgtgattacaatttccatgggcttatcgtcacc
gatgatctgacgggcatgaaagcagttagtgatcacctcaccggcccagaagcagtggtt
gctgcagtgcgcgcgggggcggatcaagcactggccgctgctggtggaattgatgttcca
gctgcggtggatgggctagctcgggcgatctccagcggcaagattccacgtgaacgcgcc
atcgcctccgccgatcgcggttgcttgccgagctag

DBGET integrated database retrieval system