KEGG   Corynebacterium resistens: CRES_0649Help
Entry
CRES_0649         CDS       T01538                                 

Gene name
gpmB
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
crd  Corynebacterium resistens
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CRES_0649 (gpmB)
   01230 Biosynthesis of amino acids
    CRES_0649 (gpmB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CRES_0649 (gpmB)
  Energy metabolism
   00680 Methane metabolism
    CRES_0649 (gpmB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CRES_0649 (gpmB)
Enzymes [BR:crd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     CRES_0649 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
802092..802889
Genome map
AA seq 265 aa AA seqDB search
MADRRLVLIRHGETEYNATGRMQGQLDTELSAVGRDQARVAAEVLAGWNVSRVIASDLSR
AEETARILAQPWGIEVETDRRLRETDLGAWQGASHREVDAAYPGQRAYWKHDPEWAPPQG
ETRMQVAERAFAVVDEVMRGDDFDRGVVVMVAHGGTIGALTARLLELPASHSLVFSGLGN
VCWSQLLARPQFVRNQGDSSAPAIDGSTVPLVPSSDEQWWKTPKWQLEGWNVHANAAAPA
GAPSPDEGGDANSSNSSSQDLGGGA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtggctgatcgccgcctggtgcttatccggcatggcgaaactgaatacaacgcgactggt
cgcatgcagggacagctcgatactgaattgagtgccgtggggcgtgatcaagcgcgcgta
gccgctgaggtgctggccggttggaacgtgtcacgcgtcatcgcaagcgatttgagccgt
gcggaggaaaccgcccggattcttgcgcaaccttgggggattgaggtcgaaactgatcgg
cgcctgcgggaaacggatctcggggcgtggcagggggcgtcgcacagagaggttgacgca
gcctacccgggccaacgggcgtattggaagcacgacccagagtgggcaccaccgcaggga
gaaacccgcatgcaggtggcggaacgggctttcgcggtagtggatgaagttatgcgtggc
gatgacttcgaccgcggtgtggttgtgatggtcgctcacggtggaacgattggtgcgttg
acagcacgattgttggaattgccggcaagccattccctagtcttctccgggctgggcaac
gtgtgttggtcacagctgcttgcccggccgcaattcgtccgtaaccaaggcgattccagc
gcaccggcgatcgatggttccaccgtgcccttggttccaagcagcgatgagcagtggtgg
aagaccccgaagtggcagctagagggctggaatgtgcacgcgaatgctgccgcccccgcc
ggggcgccaagcccggatgagggaggggatgcgaacagcagcaacagcagcagtcaagat
cttggtggaggtgcatag

DBGET integrated database retrieval system