KEGG   Corynebacterium resistens: CRES_0649Help
Entry
CRES_0649         CDS       T01538                                 

Gene name
gpmB
Definition
(GenBank) phosphoglycerate mutase
  KO
K22306  
glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
crd  Corynebacterium resistens
Brite
Enzymes [BR:crd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     CRES_0649 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
802092..802889
Genome map
AA seq 265 aa AA seqDB search
MADRRLVLIRHGETEYNATGRMQGQLDTELSAVGRDQARVAAEVLAGWNVSRVIASDLSR
AEETARILAQPWGIEVETDRRLRETDLGAWQGASHREVDAAYPGQRAYWKHDPEWAPPQG
ETRMQVAERAFAVVDEVMRGDDFDRGVVVMVAHGGTIGALTARLLELPASHSLVFSGLGN
VCWSQLLARPQFVRNQGDSSAPAIDGSTVPLVPSSDEQWWKTPKWQLEGWNVHANAAAPA
GAPSPDEGGDANSSNSSSQDLGGGA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtggctgatcgccgcctggtgcttatccggcatggcgaaactgaatacaacgcgactggt
cgcatgcagggacagctcgatactgaattgagtgccgtggggcgtgatcaagcgcgcgta
gccgctgaggtgctggccggttggaacgtgtcacgcgtcatcgcaagcgatttgagccgt
gcggaggaaaccgcccggattcttgcgcaaccttgggggattgaggtcgaaactgatcgg
cgcctgcgggaaacggatctcggggcgtggcagggggcgtcgcacagagaggttgacgca
gcctacccgggccaacgggcgtattggaagcacgacccagagtgggcaccaccgcaggga
gaaacccgcatgcaggtggcggaacgggctttcgcggtagtggatgaagttatgcgtggc
gatgacttcgaccgcggtgtggttgtgatggtcgctcacggtggaacgattggtgcgttg
acagcacgattgttggaattgccggcaagccattccctagtcttctccgggctgggcaac
gtgtgttggtcacagctgcttgcccggccgcaattcgtccgtaaccaaggcgattccagc
gcaccggcgatcgatggttccaccgtgcccttggttccaagcagcgatgagcagtggtgg
aagaccccgaagtggcagctagagggctggaatgtgcacgcgaatgctgccgcccccgcc
ggggcgccaagcccggatgagggaggggatgcgaacagcagcaacagcagcagtcaagat
cttggtggaggtgcatag

DBGET integrated database retrieval system