KEGG   Corynebacterium resistens: CRES_0700Help
Entry
CRES_0700         CDS       T01538                                 

Gene name
choD
Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
crd  Corynebacterium resistens
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(864365..866110)
Genome map
AA seq 581 aa AA seqDB search
MPESFRVLTMTHYDVLVIGSGFGGSVTALRLTEKGYNVGILEAGRRFEDKDFAKNSWHLK
DFLWAPKLGFFGIQRIHLLKDVMILAGAGVGGGSLNYANTLYKPESTYFQDRQWANITDW
EDELTPYYEQARKMLGVVENPTMTPADKISKQVAEEMGVGDTFRMAPVGVFFGEKVGLQG
KPCETVPDPYFGGVGPERTACHECGECMTGCRHGAKNTLLKNYLYLAEKGGAKVHDRTTV
TAIKPNGDGWIVETEATATVWQRRPKKRTFTADNLVVAAGTWGTQNLLHRMKDNGNLPKL
PPSLGKLTRTNSEALLGANTGRYDPNVDYSQGVAITSSYFPAPDTHIEPVRYGKGSNAMG
LLQTLMTDGDKLQPRVLEFIKQIFLQYKAIPRLINLRMWSQRTVINLVMQTRDNSLTTFL
KKVGPLTSLSSKQGTGEPNPTWIPEGNRATRIMAKLMPKGVAGGVWSEVANIPLTAHFLG
GCVIGSGPQHGVVDPYHRVWGYPTMFITDGSAITANPGVNPSLSITANAERAAAMWPNKG
EQDPRPAQSEGYQRITPVEPHSPMVPPTAPAALRLPITPVR
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgccggaaagctttagggtgctaactatgactcactacgacgtactagtaattggctct
ggtttcggtggatccgtgaccgcgctgcgtttgaccgaaaagggctacaacgtcggcatt
ctagaggcaggccgtcgcttcgaagacaaagacttcgcgaagaacagctggcacttgaaa
gacttcctctgggctcccaagctgggtttcttcggcatccagcgtattcatctgctcaaa
gatgtcatgatcctcgcgggagctggagtaggtggtggctccctcaattacgcgaacact
ctctacaaacccgaatcgacatacttccaagatcgtcaatgggcgaacatcacggactgg
gaagacgagctcactccgtactacgagcaggcgcggaagatgttgggcgtcgtcgaaaat
ccaacgatgacccccgccgacaaaatctcaaagcaggtcgctgaggaaatgggtgtcggt
gataccttccgtatggctcccgtgggggtgttctttggcgagaaagttgggctacaaggc
aagccctgcgagacggtgcccgatccatactttggtggcgtgggaccagaacgcacggcg
tgccacgaatgtggcgaatgcatgacaggttgccgccacggcgcgaaaaacacgttgctg
aaaaactatctgtacctcgcggaaaaaggtggcgcgaaagtgcatgatcgcaccacggtg
actgctatcaagcccaatggtgatggatggatcgtagaaaccgaggcaaccgcaacagtt
tggcaacgccggccgaaaaagcgcacctttaccgccgataacctcgtggtagcggcggga
acgtggggcacccagaacctactgcaccgcatgaaagataacggcaacctgccgaaactg
ccaccttctttggggaagctgactcgtacgaactcagaggccctgcttggtgccaatacc
ggccggtacgatccaaacgttgattactcccaaggtgtagcgattacctccagctacttc
cctgcccccgatactcacattgagccagtgcgctacggcaagggttccaatgcaatgggc
ttgctgcagaccctcatgaccgatggcgacaagttgcagccgcgagtgctggaattcatt
aagcagatcttcctgcagtacaaggcgatccctcggctcatcaacctgcggatgtggtcc
cagcgcaccgtcatcaatctggtaatgcaaacacgggataactcattgaccactttccta
aagaaagtcggtcccttgacgtccctgtcttcgaaacaaggtacgggagagcctaacccg
acctggatcccagagggcaatcgcgcgacccgcattatggcaaaactcatgccgaaggga
gtcgcaggtggtgtctggtccgaggtcgcaaacattccgctaactgcccatttcctaggc
ggatgcgtgattggttctggcccgcagcacggcgtggtggatccgtatcaccgggtgtgg
ggctaccccacgatgttcatcaccgatggttccgccatcacggctaaccctggagtgaat
ccttctttgtccatcaccgccaacgcagagcgtgcagccgcaatgtggccgaataagggt
gagcaagaccctcgaccagctcagtccgagggttaccagcgcatcacgccagtagagcca
cactcccccatggttcctcccactgcacctgctgcacttcgtttgcccatcacccctgtg
cgctaa

DBGET integrated database retrieval system