KEGG   Corynebacterium resistens: CRES_0732Help
Entry
CRES_0732         CDS       T01538                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
crd  Corynebacterium resistens
Pathway
crd00260  Glycine, serine and threonine metabolism
crd00750  Vitamin B6 metabolism
crd01100  Metabolic pathways
crd01110  Biosynthesis of secondary metabolites
crd01120  Microbial metabolism in diverse environments
crd01230  Biosynthesis of amino acids
Module
crd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CRES_0732 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CRES_0732 (thrC)
Enzymes [BR:crd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CRES_0732 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEI09089
UniProt: F8DZP1
Position
905964..907433
Genome map
AA seq 489 aa AA seqDB search
MDFISTRDANKTPVGFTNILLSGLAPDGGLYLPAEYPQLTDELLEEWRQILAKGNTAERT
AYAALAAEILKLFVDDIPAEDLEAIAARAYTTEEFSSEDIVPLTTLEDGIFLGHLSEGPT
AAFKDMAMQLLGELFEYELARRGETLNILGATSGDTGSSAEYAMRGRDGIRVFMLTPAGR
MTPFQQAQMFSLEDPNIFNIALDGVFDDCQDIVKEVSSDAEFKRDNRIGAVNSINWARLM
AQIVYYVACWLRATERNDEKVSFSVPTGNFGDICAGHIARQMGLPIDRLIVATNENDVLD
EFFRTGNYKVRTAEQTWATSSPSMDISRASNFERFIFDLLGRDAERTADLFGVKVKQGGF
SLAEDAVFAEAADRYGFLSASSTHADRVACIADAEKRLSTLIDPHTADGVNAARAVREQV
DTPIVVLETALPVKFSETIVEATGKEPEVPARFAKIMDGGRYVKDLPNDAGVVKQYILDS
IAKTKEIEN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtggacttcatatcaacgcgcgatgccaataaaacgccagtcggcttcacgaacatttta
ttgtccgggttggcccccgacggcggtttgtatcttcctgcagaatacccgcaacttacc
gacgagttgcttgaggaatggcgccagattcttgccaaggggaatacggctgagcggacc
gcttatgcagcacttgctgcagagattctcaagctgttcgttgatgacatccccgccgaa
gacctcgaagcaatcgcagcccgcgcgtacaccacggaagagttctcttcggaggacatc
gtgccgttgaccactttggaagacggcatcttccttggacacctttcggaggggccaacc
gcagctttcaaagacatggcgatgcagctgttgggagagctctttgaatacgagctcgcc
cgccgtggcgaaaccctcaacatcctcggtgcgaccagtggtgataccggaagttccgca
gagtatgcaatgcgtggccgcgacggtattcgcgtattcatgctcaccccagctggtcgt
atgacacctttccagcaagcgcagatgtttagccttgaggaccccaacatctttaacatt
gccctcgatggagtcttcgatgactgccaggacattgttaaggaagttagctcggatgcc
gaattcaaacgcgataaccgcatcggcgcggtgaattccatcaactgggcgcggctaatg
gcgcagatcgtttactacgttgcgtgctggttgcgtgctacggaacgcaacgatgagaag
gtcagcttctcggttcccacggggaattttggcgatatctgcgcgggccacatcgcccgt
cagatggggctacccatcgaccgccttatcgtcgcgaccaatgaaaacgatgtgctcgat
gagttcttccgcactggcaactataaggtacgtaccgcggagcaaacctgggccacgtcc
agcccctctatggacatcagccgggcgtcgaacttcgaacggttcatctttgacttgctc
ggccgagacgccgaacgcacggccgacctgttcggcgtaaaggtcaagcagggtgggttt
agtctggccgaagatgcggtgttcgcggaggctgcggatcgttacggcttcctatcggct
tcttcgacgcacgctgatcgggttgcttgtatcgccgacgccgaaaagcgcctgagtacg
ttgatcgacccgcacaccgccgatggcgtcaacgcggcccgtgccgtgcgcgagcaggta
gacacaccgattgttgtgctggaaaccgcactgcccgtgaagttctccgaaaccatcgtg
gaagccaccggcaaggagccagaggtgcccgcgcgtttcgcgaagattatggacggcggg
cggtacgtcaaggatctgcctaatgatgctggggtagtgaagcagtacattctggattcg
attgccaagaccaaggagatcgagaactaa

DBGET integrated database retrieval system