KEGG   Corynebacterium resistens: CRES_0732Help
Entry
CRES_0732         CDS       T01538                                 

Gene name
thrC
Definition
(RefSeq) Threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
crd  Corynebacterium resistens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CRES_0732 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CRES_0732 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CRES_0732 (thrC)
Enzymes [BR:crd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CRES_0732 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
905964..907433
Genome map
AA seq 489 aa AA seqDB search
MDFISTRDANKTPVGFTNILLSGLAPDGGLYLPAEYPQLTDELLEEWRQILAKGNTAERT
AYAALAAEILKLFVDDIPAEDLEAIAARAYTTEEFSSEDIVPLTTLEDGIFLGHLSEGPT
AAFKDMAMQLLGELFEYELARRGETLNILGATSGDTGSSAEYAMRGRDGIRVFMLTPAGR
MTPFQQAQMFSLEDPNIFNIALDGVFDDCQDIVKEVSSDAEFKRDNRIGAVNSINWARLM
AQIVYYVACWLRATERNDEKVSFSVPTGNFGDICAGHIARQMGLPIDRLIVATNENDVLD
EFFRTGNYKVRTAEQTWATSSPSMDISRASNFERFIFDLLGRDAERTADLFGVKVKQGGF
SLAEDAVFAEAADRYGFLSASSTHADRVACIADAEKRLSTLIDPHTADGVNAARAVREQV
DTPIVVLETALPVKFSETIVEATGKEPEVPARFAKIMDGGRYVKDLPNDAGVVKQYILDS
IAKTKEIEN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtggacttcatatcaacgcgcgatgccaataaaacgccagtcggcttcacgaacatttta
ttgtccgggttggcccccgacggcggtttgtatcttcctgcagaatacccgcaacttacc
gacgagttgcttgaggaatggcgccagattcttgccaaggggaatacggctgagcggacc
gcttatgcagcacttgctgcagagattctcaagctgttcgttgatgacatccccgccgaa
gacctcgaagcaatcgcagcccgcgcgtacaccacggaagagttctcttcggaggacatc
gtgccgttgaccactttggaagacggcatcttccttggacacctttcggaggggccaacc
gcagctttcaaagacatggcgatgcagctgttgggagagctctttgaatacgagctcgcc
cgccgtggcgaaaccctcaacatcctcggtgcgaccagtggtgataccggaagttccgca
gagtatgcaatgcgtggccgcgacggtattcgcgtattcatgctcaccccagctggtcgt
atgacacctttccagcaagcgcagatgtttagccttgaggaccccaacatctttaacatt
gccctcgatggagtcttcgatgactgccaggacattgttaaggaagttagctcggatgcc
gaattcaaacgcgataaccgcatcggcgcggtgaattccatcaactgggcgcggctaatg
gcgcagatcgtttactacgttgcgtgctggttgcgtgctacggaacgcaacgatgagaag
gtcagcttctcggttcccacggggaattttggcgatatctgcgcgggccacatcgcccgt
cagatggggctacccatcgaccgccttatcgtcgcgaccaatgaaaacgatgtgctcgat
gagttcttccgcactggcaactataaggtacgtaccgcggagcaaacctgggccacgtcc
agcccctctatggacatcagccgggcgtcgaacttcgaacggttcatctttgacttgctc
ggccgagacgccgaacgcacggccgacctgttcggcgtaaaggtcaagcagggtgggttt
agtctggccgaagatgcggtgttcgcggaggctgcggatcgttacggcttcctatcggct
tcttcgacgcacgctgatcgggttgcttgtatcgccgacgccgaaaagcgcctgagtacg
ttgatcgacccgcacaccgccgatggcgtcaacgcggcccgtgccgtgcgcgagcaggta
gacacaccgattgttgtgctggaaaccgcactgcccgtgaagttctccgaaaccatcgtg
gaagccaccggcaaggagccagaggtgcccgcgcgtttcgcgaagattatggacggcggg
cggtacgtcaaggatctgcctaatgatgctggggtagtgaagcagtacattctggattcg
attgccaagaccaaggagatcgagaactaa

DBGET integrated database retrieval system