KEGG   Corynebacterium resistens: CRES_0746Help
Entry
CRES_0746         CDS       T01538                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
crd  Corynebacterium resistens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CRES_0746 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CRES_0746 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CRES_0746 (sucB)
Enzymes [BR:crd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CRES_0746 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(922216..924339)
Genome map
AA seq 707 aa AA seqDB search
MAHSVEMPELGESVTEGTVTQWLKKVGDKVEVDEPLLEVSTDKVDTEIPSPVAGVLLKIL
ADEDDTVDVGTVIAEIGDEGEEASSDDDAKESSDEGSAGDDASDEDAADSSAAEGADSES
SDDNAGSGEAEDVKMPELGESVTEGTITQWLKKVGDKVEVDEPLLEVSTDKVDTEVPSPV
AGTLVEILAEEDDTVDVGEVIARVGDGSAKPSKADKKSDEGKSEDESDKAAAEDKAASKK
EDLSSDDDSESSDDNAGSGEAEDVKMPELGESVTEGTITQWLKKVGDKVEVDEPLLEVST
DKVDTEVPSPVAGTLVEILAEEDDTVDVGEVIARVGDGSAKPSKADKKSDEDKSAAKDEA
NKAEDKPAEKKEDKPAKSAAASSKPSASTNKPAEGNLPYVTPLVRKLADKHEVDLSTIKG
TGVGGRIRKQDVLAAANGGGAATASSVAEQSPAGPRASTHRVDLSKQDLRGTTQKVNRIR
EITAKKTLESLHSAAQLTQVHEVDMTHVADLRKQSKADFQKKHGVNLTYLPFFAKAIVEA
LVSHPNVNASYNAQTREMTYHEQVNLGIAVDTPAGLLSPVIHNAQDMSLPELAKAIVDIA
DRARNNKLKPQDLAGGTFTITNIGSEGALTDTPILVPPQAAMVGTGAIVRRPVVLSEDGG
ESIGIRSMVFLPMTYDHQVIDGADAGRFMSTVRDRLEHGDFETDLEL
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgtcgaaatgcccgagttgggcgagtccgtaaccgaaggcactgttacc
cagtggctgaagaaggtcggcgacaaggttgaagtagacgagcctttgctggaggtctcc
accgataaggtcgatactgagatcccatccccagtcgctggtgtgctgcttaagatcttg
gctgatgaagatgacaccgtagatgtcggaaccgttattgctgagatcggcgatgagggc
gaagaagcttcttccgatgatgacgccaaggaatcctccgatgagggctccgcaggcgat
gacgcatccgacgaagacgctgcagattcctccgccgccgaaggtgccgattctgagtcc
agcgatgataacgctggttctggcgaggcagaagacgtgaagatgccagaactcggtgag
tccgtcaccgagggcaccatcacccagtggctgaagaaggtcggcgacaaggtcgaggtc
gacgagccactgctcgaagtctccaccgacaaggtcgatactgaggtcccatccccagta
gcaggcaccctggttgaaatcctcgccgaagaagacgacaccgtagacgtcggtgaagtc
atcgcccgcgttggcgacggcagcgcaaagccatccaaggcagacaagaagtccgacgaa
ggaaagtcagaggacgagagcgataaggctgccgcagaggacaaggcggcgtcgaagaag
gaagatctttccagcgacgatgattccgagtccagcgatgataacgctggttccggcgag
gcagaagatgtgaagatgccagaactcggtgagtccgtcaccgagggcaccatcacccag
tggttgaagaaggtcggcgacaaggtcgaggtcgacgagccactgctcgaagtctccacc
gacaaggtcgatactgaggttccatccccagtagcaggcaccctggttgaaattctcgcc
gaagaagacgacaccgtagacgtcggcgaagtcatcgcccgtgtcggcgacggcagcgca
aagccatccaaggctgacaagaagtccgacgaggataagagtgctgcgaaggacgaggct
aacaaggctgaggacaagcctgctgagaagaaggaagataagccagccaagagcgcggcc
gcttccagcaagccctccgcttccaccaacaagcctgccgaaggcaacctgccgtacgta
accccgctggtacgcaagctggcggacaagcacgaagttgatctttccacgatcaagggc
accggcgttggtggccgtatccgcaagcaggacgtcctcgccgcagccaacggtggcggt
gccgcaaccgcttcctccgttgctgagcagtcccctgctggtccacgggcctccactcac
cgtgttgacctgtccaaacaggatctgcgtggtacgacccagaaggtcaaccgcatccgc
gagatcacggcgaagaagaccctcgagtccctccactctgcagcgcagctgacccaggtt
cacgaggttgatatgacgcacgtggctgacctgcgcaagcagtccaaggcggacttccaa
aagaagcacggagttaacctgacctacctgccattcttcgcgaaggcaatcgtggaggct
ctggtttcccacccgaacgtcaatgcttcatacaatgcgcagacccgcgagatgacctac
cacgagcaggtcaacctcggaatcgcagtggataccccagctggcctgctgagcccagtg
atccacaacgcgcaggacatgagcctgccagagctagccaaggctatcgttgacatcgcc
gatcgtgctcgcaataacaagctgaagccacaggatctggctggcggtaccttcaccatc
accaacatcggttccgagggcgcgctgaccgatactccaatcctcgtgccaccacaggca
gcgatggttggcaccggcgcgatcgttcgtcgcccggttgtgctttccgaagatggtggc
gagtccattggcatccgttccatggtgttcctgccaatgacctacgatcaccaagtcatc
gacggcgctgatgctggtcgcttcatgtccacggttcgcgatcgcctggagcatggcgac
tttgagaccgatctggagctctaa

DBGET integrated database retrieval system