KEGG   Corynebacterium resistens: CRES_0770Help
Entry
CRES_0770         CDS       T01538                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
crd  Corynebacterium resistens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CRES_0770 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CRES_0770 (glk)
   00052 Galactose metabolism
    CRES_0770 (glk)
   00500 Starch and sucrose metabolism
    CRES_0770 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CRES_0770 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CRES_0770 (glk)
   00524 Butirosin and neomycin biosynthesis
    CRES_0770 (glk)
Enzymes [BR:crd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CRES_0770 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
952682..953704
Genome map
AA seq 340 aa AA seqDB search
MGRKRETGKGNTSVTEDFLTIGVDIGGTNFRAAVVDESGTILAVEQLPTPSNVEALEKAL
EQVITQLCEQHSTAKRPIVAVGLAIAGFIDETRTHVRFAPHLPWRNTELVQRLRRRLELP
VVIEHDANSAAWGEYFQGAAQGEDTWVLFALGTGIGAAVMHKGEIYRGAFGTAPEFGHLT
VMPGGRACPCGKMGCLERYCSGSALPLTAQDFIATGCCPESALTKTYANHPEEITGRAVV
RLAREGDGLALDVVDDMATWLGRGLALVQDVFDPSLIVLGGGVSQDADLFLPAAREVMAN
NIVGAGHRRVARVVQGQLGGDAGMIGVALLARREADPQKQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggacgaaagcgcgaaaccggaaagggcaacacgagcgtgacggaagactttctcaca
attggtgtggatatcggaggaaccaacttccgggccgccgtggtcgatgaaagcggcact
attttagccgtggaacagttgcccacaccctccaacgtcgaagccttggagaaagcgctc
gaacaagtgatcacccagctatgcgaacagcattccacggccaagcgtccgatcgttgcc
gtggggttagctatcgccgggttcattgacgaaacacgcacgcacgtccggttcgcacca
catttgccatggcgcaatacggaactcgtgcagcgcctccgccgccggctggagttgccg
gtagttatcgagcatgacgccaactcggccgcttggggtgaatacttccaaggagccgct
caaggtgaagacacttgggtgctctttgccctggggacaggcattggcgctgcggtaatg
cataaaggcgaaatttatcgtggggccttcgggacagccccagagtttggccatctaacg
gtgatgcccggtggtcgagcatgcccctgcgggaagatgggctgtctcgaacgctactgt
tccggttctgcccttccgctcaccgcacaggatttcatcgcaactggatgttgccctgaa
tccgcgttgactaaaacttacgcgaatcatccagaggaaataaccggccgagcagttgta
cgcctcgcgcgtgagggtgacggtctggccctcgatgtcgttgacgatatggcaacgtgg
ctcggtagggggctcgcgctggtacaggacgtgtttgacccatccctcatcgttcttggc
ggtggtgtttcacaagatgcggaccttttcttaccagcagcccgtgaggtcatggccaac
aacatcgtaggggccgggcaccgtcgcgttgcgcgcgtggtgcagggtcaactgggaggc
gatgccggtatgatcggcgtagcactattggcgaggcgcgaagctgacccgcaaaagcaa
taa

DBGET integrated database retrieval system