KEGG   Corynebacterium resistens: CRES_0829Help
Entry
CRES_0829         CDS       T01538                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
crd  Corynebacterium resistens
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:crd01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:crd00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1021885..1023201
Genome map
AA seq 438 aa AA seqDB search
MTSLQLARIDLRGTTPTTASLRHSLPRGGTDVESVLPTVAPVVEDIRAGGAAAALRYGEK
FDGVVPPAVKVPQSLLDAATEELDDEVISALNEAIKRVRAFHSTQVPADHEEEIAPGGIV
GERYIPIRRVGLYVPGGKAVYPSSVIMNVVPAQEAGVESLVVASPPQENGWPHPTVLAAC
KLLGVTEVWAVGGAQAVALMAYGDDSEQLEPVDMITGPGNIFVTAAKRLVRSVVGIDSEA
GPTEIAVLADDSADAVEVAYDLISQAEHDPMAASVLITDSPAFADEVEKEVAARYSVTLN
ADRVREALEGEQSGIVVVDDLEMAIQVADAYAAEHLEIHTREAEAVASRITNAGAIFIGR
YSPVPLGDYAAGSNHVLPTSGTARHASGLSTHTFLKAVHVVNYSQQALADVSQTVITLAN
AERLPAHGEAIKARLERN
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgttgcagcttgcacgcattgacttgcgtggcaccactccgactacggcaagc
ctccgtcatagcctcccacgtggtgggacagatgtggaatccgtcttgcccacggtggct
cccgttgtggaggatatccgcgccggcggcgccgctgccgcattgcgctatggcgagaag
ttcgatggcgtggtgccacctgctgtgaaggtaccccaatcacttctcgacgccgccacg
gaagagctcgacgatgaagtgatcagtgccctgaacgaagcgatcaagcgggtgcgggcc
ttccactccactcaggtaccagctgatcatgaggaggagatcgcccccggcggaattgtc
ggcgagcgctatattccaatccgtcgcgttggattgtatgttcccggtgggaaagccgtg
tacccctccagcgtgatcatgaatgtggtgcctgcacaagaagcaggggttgaatcgctc
gtggtggcgtcgcccccacaagaaaacggctggccacaccccacggtgctggcggcctgc
aaacttctcggcgtgactgaagtgtgggccgtgggcggagcccaggctgtggcgctgatg
gcttatggcgatgacagcgagcagctggagccggtggatatgatcactggtccgggcaat
attttcgtgacggctgccaaacggctggtacgaagtgtggtgggcatcgattcggaggcg
gggccaaccgaaatcgcggtgcttgccgacgacagcgcggatgcggtggaggtggcatac
gacctcattagccaagcagagcacgatcccatggcggcgagtgtgctgatcaccgattcg
ccagctttcgccgatgaggtggagaaagaggttgccgcccggtattccgtcaccttgaat
gccgatcgcgttcgagaagccctagagggagagcagtccggcatcgtggttgttgacgat
ctggaaatggctatccaagttgccgatgcttatgcggcggaacacctagaaatccacact
cgtgaggcggaggcagtggcttcgcgaatcacgaatgccggagcgatcttcattgggcgc
tacagcccagttccgttgggagattatgcggccggctccaatcacgtgctgccaacatcg
ggcacggcacgtcacgcctcgggcttgtccacgcacacattcttgaaagccgtccacgtg
gtgaattactcccagcaagcactcgcggacgtgtcgcagaccgtaattactctggctaat
gccgagcgccttcctgcccatggcgaggcgatcaaggcccggctggaaaggaattga

DBGET integrated database retrieval system