KEGG   Corynebacterium resistens: CRES_0841Help
Entry
CRES_0841         CDS       T01538                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
crd  Corynebacterium resistens
Pathway
crd00260  Glycine, serine and threonine metabolism
crd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
crd01100  Metabolic pathways
crd01110  Biosynthesis of secondary metabolites
crd01130  Biosynthesis of antibiotics
crd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CRES_0841 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CRES_0841 (trpB)
Enzymes [BR:crd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CRES_0841 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEI09197
UniProt: F8E0F6
Position
1033006..1034250
Genome map
AA seq 414 aa AA seqDB search
MSDKTPLPTAGEVLATPTHHEPDERGHWGDFGGRYVPEALMAVIDEITDAWSKAKADQAY
LNELDELHRTYTGRPSPLYFAQRFSEAVGANVWLKREDLNHTGSHKINNVLGQVLLAKRM
GKTRVIAETGAGQHGVATATACALMGIECRIYMGEVDANRQALNIARMRLLGAQVEVVTI
GSRTLKDAINEAMRFWVAHAEDTYYCFGTAAGPHPFPQMVRDLQRVIGTEARQQILDETG
KLPDAVVACVGGGSNAIGLFHPFINDESVQIFGAEAAGDGLESGRHAAPINMGLQGVFQG
AFSDLMQNEDGQIIESHSISAGLDYPGVGPEHSQLHSEGRAEYLAITDAEAMDAFQQLSR
TEGIIPAIESAHAVAAAIKVAARLPGSTIIVNLSGRGDKDVDTAAKWFNEEGEK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgacaaaaccccattgccaacagcgggcgaagttttagcgacgcccacccatcat
gaacccgacgagcgtggtcactggggtgacttcggtggtcggtacgttcccgaggccctc
atggccgttatcgatgagatcactgatgcatggtccaaggcgaaggctgatcaggcttat
ttgaatgagcttgacgagctgcatcgcacttataccggccgaccttcgcctttgtatttc
gcacagcgtttttcggaggctgtaggggccaacgtctggttgaagcgcgaagatctgaac
cacactggttcacacaaaatcaacaatgtcctcggccaggtgcttctcgccaagcgaatg
gggaagacccgtgtcatcgctgagaccggtgcgggtcaacacggagtggctaccgccacc
gcgtgtgccttgatgggcatcgaatgccgcatttacatgggcgaagtagatgctaaccgg
caggccttgaacattgcccgcatgcgtttgttgggtgcgcaggtggaagtagtcactatt
ggttctcgcacgctgaaggacgcgattaacgaagccatgcgcttctgggtagcccacgcc
gaggacacgtattactgcttcggtaccgctgctggacctcacccattcccgcagatggtg
agggatttgcagcgtgtaatcgggaccgaggcgcgccagcagattctcgatgaaaccggc
aaacttcccgacgccgtggtggcgtgcgtgggcggtggctccaacgccatcgggctgttc
caccccttcattaacgatgaatctgtgcagattttcggagcggaagcggcaggtgatggc
ctagaatccgggcgccacgcagctccgatcaacatgggcctgcagggcgtattccaaggc
gcgttctctgatctcatgcaaaacgaggacggtcagatcatcgagtcccattcgatttcc
gctggtttggattacccgggtgtcggccccgagcactcgcagttgcacagcgaaggccga
gctgagtacctcgcgatcaccgatgcggaggcgatggatgccttccaacagctgtcgcgt
accgagggtattatcccagcaattgaatcggcacacgctgtagccgccgcgattaaggtg
gcagcccgcctacctggctcaacgatcattgtgaacctttcgggccgtggcgataaggat
gttgataccgctgcgaagtggtttaacgaagaaggggagaagtag

DBGET integrated database retrieval system