KEGG   Corynebacterium resistens: CRES_0841Help
Entry
CRES_0841         CDS       T01538                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
crd  Corynebacterium resistens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CRES_0841 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CRES_0841 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CRES_0841 (trpB)
Enzymes [BR:crd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CRES_0841 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1033006..1034250
Genome map
AA seq 414 aa AA seqDB search
MSDKTPLPTAGEVLATPTHHEPDERGHWGDFGGRYVPEALMAVIDEITDAWSKAKADQAY
LNELDELHRTYTGRPSPLYFAQRFSEAVGANVWLKREDLNHTGSHKINNVLGQVLLAKRM
GKTRVIAETGAGQHGVATATACALMGIECRIYMGEVDANRQALNIARMRLLGAQVEVVTI
GSRTLKDAINEAMRFWVAHAEDTYYCFGTAAGPHPFPQMVRDLQRVIGTEARQQILDETG
KLPDAVVACVGGGSNAIGLFHPFINDESVQIFGAEAAGDGLESGRHAAPINMGLQGVFQG
AFSDLMQNEDGQIIESHSISAGLDYPGVGPEHSQLHSEGRAEYLAITDAEAMDAFQQLSR
TEGIIPAIESAHAVAAAIKVAARLPGSTIIVNLSGRGDKDVDTAAKWFNEEGEK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgacaaaaccccattgccaacagcgggcgaagttttagcgacgcccacccatcat
gaacccgacgagcgtggtcactggggtgacttcggtggtcggtacgttcccgaggccctc
atggccgttatcgatgagatcactgatgcatggtccaaggcgaaggctgatcaggcttat
ttgaatgagcttgacgagctgcatcgcacttataccggccgaccttcgcctttgtatttc
gcacagcgtttttcggaggctgtaggggccaacgtctggttgaagcgcgaagatctgaac
cacactggttcacacaaaatcaacaatgtcctcggccaggtgcttctcgccaagcgaatg
gggaagacccgtgtcatcgctgagaccggtgcgggtcaacacggagtggctaccgccacc
gcgtgtgccttgatgggcatcgaatgccgcatttacatgggcgaagtagatgctaaccgg
caggccttgaacattgcccgcatgcgtttgttgggtgcgcaggtggaagtagtcactatt
ggttctcgcacgctgaaggacgcgattaacgaagccatgcgcttctgggtagcccacgcc
gaggacacgtattactgcttcggtaccgctgctggacctcacccattcccgcagatggtg
agggatttgcagcgtgtaatcgggaccgaggcgcgccagcagattctcgatgaaaccggc
aaacttcccgacgccgtggtggcgtgcgtgggcggtggctccaacgccatcgggctgttc
caccccttcattaacgatgaatctgtgcagattttcggagcggaagcggcaggtgatggc
ctagaatccgggcgccacgcagctccgatcaacatgggcctgcagggcgtattccaaggc
gcgttctctgatctcatgcaaaacgaggacggtcagatcatcgagtcccattcgatttcc
gctggtttggattacccgggtgtcggccccgagcactcgcagttgcacagcgaaggccga
gctgagtacctcgcgatcaccgatgcggaggcgatggatgccttccaacagctgtcgcgt
accgagggtattatcccagcaattgaatcggcacacgctgtagccgccgcgattaaggtg
gcagcccgcctacctggctcaacgatcattgtgaacctttcgggccgtggcgataaggat
gttgataccgctgcgaagtggtttaacgaagaaggggagaagtag

DBGET integrated database retrieval system