KEGG   Corynebacterium resistens: CRES_0842Help
Entry
CRES_0842         CDS       T01538                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
crd  Corynebacterium resistens
Pathway
crd00260  Glycine, serine and threonine metabolism
crd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
crd01100  Metabolic pathways
crd01110  Biosynthesis of secondary metabolites
crd01130  Biosynthesis of antibiotics
crd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CRES_0842 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CRES_0842 (trpA)
Enzymes [BR:crd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CRES_0842 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth KfrA_N PcrB BtpA NMO
Motif
Other DBs
NCBI-ProteinID: AEI09198
UniProt: F8E0F7
Position
1034253..1035047
Genome map
AA seq 264 aa AA seqDB search
MSESRSESRLAQVFRRANAEDRAAFVAYMTAGFPNAEVSREIFSALAQHADLIEVGIPFT
DPMMDGPTIQAAADEALANGFRVAQTFDAVRAVTEAGGQAVIMSYWNPVLQYGPERFAAE
LAAAGGLGSIIPDLLPEEAARWAKACEEHDLSPVYLVAPSTTAERMEITVNAGNGFIYAA
SHMGVTGAQEQVSSHARELVERTRQATDLPVAVGLGVRDGKQAAAIAEFADGVIVGSALI
QAVQSGGQEEMLSLARELQEGCQR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagtcccgtagcgaatctcgtttggctcaagtctttcgtcgcgccaacgcggaa
gaccgcgctgcttttgttgcctacatgactgcgggtttccccaatgcggaagtgtcgcgc
gagattttcagcgccctcgcgcagcatgcggatctcattgaggtcggcattccattcacg
gatcccatgatggatggcccgacgattcaggctgctgccgatgaggctctagccaatggc
ttccgcgtggcccagacctttgatgcggttcgtgctgtcaccgaagccgggggccaagct
gtaatcatgagctactggaaccccgtgctgcagtacgggccagagcgtttcgctgcagaa
ctcgctgcagccggcggtttgggcagcattattccggacttgctgccggaggaggctgct
cggtgggcgaaggcatgtgaggaacatgacctttcccccgtttaccttgtggcgccatcc
actactgctgagcgcatggagatcactgtgaacgcgggtaatggctttatctatgcagcc
tcccacatgggcgttacgggcgctcaggaacaagtttcctcccatgcgcgtgagcttgtg
gagcgtacccgccaggccaccgatctgcccgtcgccgtgggcttgggcgtacgcgatggc
aagcaagccgcggcgatcgctgagttcgccgatggcgtgatcgtgggctccgccctcatc
caagcggtgcagtctggagggcaggaagaaatgctttcgctcgcccgcgagctgcaggag
ggctgccagcgctga

DBGET integrated database retrieval system