KEGG   Corynebacterium resistens: CRES_0842Help
Entry
CRES_0842         CDS       T01538                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
crd  Corynebacterium resistens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CRES_0842 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CRES_0842 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CRES_0842 (trpA)
Enzymes [BR:crd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CRES_0842 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1034253..1035047
Genome map
AA seq 264 aa AA seqDB search
MSESRSESRLAQVFRRANAEDRAAFVAYMTAGFPNAEVSREIFSALAQHADLIEVGIPFT
DPMMDGPTIQAAADEALANGFRVAQTFDAVRAVTEAGGQAVIMSYWNPVLQYGPERFAAE
LAAAGGLGSIIPDLLPEEAARWAKACEEHDLSPVYLVAPSTTAERMEITVNAGNGFIYAA
SHMGVTGAQEQVSSHARELVERTRQATDLPVAVGLGVRDGKQAAAIAEFADGVIVGSALI
QAVQSGGQEEMLSLARELQEGCQR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagtcccgtagcgaatctcgtttggctcaagtctttcgtcgcgccaacgcggaa
gaccgcgctgcttttgttgcctacatgactgcgggtttccccaatgcggaagtgtcgcgc
gagattttcagcgccctcgcgcagcatgcggatctcattgaggtcggcattccattcacg
gatcccatgatggatggcccgacgattcaggctgctgccgatgaggctctagccaatggc
ttccgcgtggcccagacctttgatgcggttcgtgctgtcaccgaagccgggggccaagct
gtaatcatgagctactggaaccccgtgctgcagtacgggccagagcgtttcgctgcagaa
ctcgctgcagccggcggtttgggcagcattattccggacttgctgccggaggaggctgct
cggtgggcgaaggcatgtgaggaacatgacctttcccccgtttaccttgtggcgccatcc
actactgctgagcgcatggagatcactgtgaacgcgggtaatggctttatctatgcagcc
tcccacatgggcgttacgggcgctcaggaacaagtttcctcccatgcgcgtgagcttgtg
gagcgtacccgccaggccaccgatctgcccgtcgccgtgggcttgggcgtacgcgatggc
aagcaagccgcggcgatcgctgagttcgccgatggcgtgatcgtgggctccgccctcatc
caagcggtgcagtctggagggcaggaagaaatgctttcgctcgcccgcgagctgcaggag
ggctgccagcgctga

DBGET integrated database retrieval system