KEGG   Corynebacterium resistens: CRES_1080Help
Entry
CRES_1080         CDS       T01538                                 

Gene name
tpi
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
crd  Corynebacterium resistens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CRES_1080 (tpi)
   01230 Biosynthesis of amino acids
    CRES_1080 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CRES_1080 (tpi)
   00051 Fructose and mannose metabolism
    CRES_1080 (tpi)
   00562 Inositol phosphate metabolism
    CRES_1080 (tpi)
Enzymes [BR:crd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CRES_1080 (tpi)
Exosome [BR:crd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CRES_1080 (tpi)
  Exosomal proteins of bladder cancer cells
   CRES_1080 (tpi)
  Exosomal proteins of melanoma cells
   CRES_1080 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1319955..1320734)
Genome map
AA seq 259 aa AA seqDB search
MTQRTPLIAGNWKMNLNHLEAIQVVQRFDFALPKDYYDKVDVAFIPPFTDIRSVQTVADG
EKMLFTYGAQDVSEHESGAYTGEVSASMLAKLGCSWVVVGHSERRQYHNESDELVARKAK
ATLQAGMSPIVCVGEPLEVREAGEHVDYVVKQTRASLEGLGKDDVAKTVIAYEPVWAIGT
GKVASAADAQEVCKAIRALIAELTDDEVAAGIRILYGGSVKTDSVAEIVSQPDVDGGLVG
GASLDGGDFAKLVAAAAKA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgactcagcgcaccccgttgatcgctggaaactggaagatgaatctgaaccacctcgag
gcaattcaggtggtgcaaagattcgattttgccttgccgaaggattactacgacaaagtg
gatgtcgctttcatcccaccatttactgacattcgttcggtacagacggttgcggatggc
gaaaagatgttgttcacctatggtgcacaggatgtaagcgagcacgaatctggcgcgtac
acaggtgaagtatccgccagcatgctcgccaaattgggctgcagctgggtggtagtaggg
cactctgagcgtcggcaataccacaatgagtcagacgaactcgtggcacgcaaggcaaaa
gccactctccaagctggaatgagccccatcgtttgtgtcggtgagcctctcgaagtacgg
gaggcaggggagcatgtggactacgtcgtgaagcaaactcgcgcttcgttggaagggctt
ggcaaggacgatgtggcgaagaccgtcatcgcctacgaacccgtctgggctatcggaacg
ggcaaggtggcatctgctgctgatgctcaagaagtgtgcaaggccatccgtgcgctgatt
gcggaactgacagacgacgaggtagcagcaggcattcgcatcctctacggcggatcagtc
aagacggactcggtggcagagatcgtatcccagccagacgtcgatggcggtttggttggc
ggggccagcttggacggcggtgacttcgcgaaactcgtcgctgcggccgccaaggcttag

DBGET integrated database retrieval system