KEGG   Corynebacterium resistens: CRES_1135Help
Entry
CRES_1135         CDS       T01538                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
crd  Corynebacterium resistens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:crd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CRES_1135 (ruvA)
Enzymes [BR:crd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CRES_1135 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1388351..1388977)
Genome map
AA seq 208 aa AA seqDB search
MIASLRGTVIDKGLDYVVVECSGVGYHCHTTPAIVGTLERGTEAFVLTTLVVREDAQTLY
AFTDSDQRQTFLALQKVSGVGARVALAIMSVLTPAELAAAVAEGDAKTLQRAPGVGKRLA
ERMVVDLKGKLGALSSEVSTPGAPSPDSPQGLSDSVREQVEEALVGLGFTEAKAASTVSQ
AVARTEDAGLLDASSLLRAALAQIGGSK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgattgcctcgctgcgcggaactgtgatcgataagggcctcgactacgtcgtggtggaa
tgcagtggcgtggggtaccactgccacaccacacccgcgatcgtgggaactttggaacgc
ggtacagaagcctttgtgctgaccaccttggtggtgcgtgaggacgcgcaaaccctgtac
gcattcaccgattctgatcagcgacaaaccttcttggcgctgcagaaggtctcaggcgtg
ggagcacgtgtggctctggccatcatgagcgttttgacacccgcggaacttgccgcagcc
gtggctgagggggatgccaagaccctgcaacgagctcctggtgtgggcaaacgcctcgcc
gaacgcatggtcgttgatctcaagggcaagctcggtgctttgtcttctgaggtatcgacg
cctggcgctccgtcccccgactctccgcagggcttgagtgattccgtacgcgagcaggtg
gaagaagctctggtgggcctgggctttacagaggcaaaggcagcctccaccgtgtcgcag
gccgttgcgcgcacggaagacgctggtttgctcgatgcctcgagtctgctgcgggcagcc
ctcgcacagatcggcggcagcaagtag

DBGET integrated database retrieval system