KEGG   Corynebacterium resistens: CRES_1157Help
Entry
CRES_1157         CDS       T01538                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
crd  Corynebacterium resistens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CRES_1157 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CRES_1157 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    CRES_1157 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CRES_1157 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CRES_1157 (adhA)
   00626 Naphthalene degradation
    CRES_1157 (adhA)
Enzymes [BR:crd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CRES_1157 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1405594..1406625
Genome map
AA seq 343 aa AA seqDB search
MSAPTFFRAAVVEEFGPEVNVRDVDLPKPDRHQALVKLHASGVCHTDLHAAEGDWPVKPE
PPFVPGHEGVGEIVELGPGDHDLKVGDMVGNVWLWSACGTCEHCRTGWETLCNDAEYGGY
TVNGSFGEYMLVDTRYCARIPEGSDPVEVAPILCAGVTVYKGLKVAETRPGQFMVISGAG
GLGHIAVQYAVAMGMRVIAVDIADDKLELAKRHGAEFTVNAKHSDPAEAVQEYTGGGAHG
VLVTAVHEAAFGQAIGMARKGGTIVFNGLPPGDFPAPIFEIVFKALTIRGSLVGTRQDLE
EALDFYARGMIKPTVHECSLDDVNSVFEDMRHGKIEGRMSIKY
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcacccaccttcttccgcgccgccgtcgtcgaggaattcggccccgaggtcaac
gtccgcgacgttgacctgccgaagccggaccgccaccaggcgctggtgaagctccacgcc
tccggcgtctgccacaccgacctccacgccgccgagggcgactggcccgtgaagccggag
ccgccgttcgtgccgggccacgagggcgtcggcgagatcgtcgagctcggcccgggcgac
cacgacctcaaggtcggtgacatggtcggcaacgtgtggctgtggtccgcctgcggcacc
tgtgagcactgccgcaccggctgggagaccctgtgcaacgacgccgagtacggcggctac
accgtcaacggctccttcggcgaatacatgctcgtcgacacccgctactgcgcccgcatc
cccgagggctccgacccggtcgaggtcgccccgatcctctgcgccggcgtcaccgtctac
aagggccttaaggtcgcggagaccaggcccggccagttcatggtcatctccggcgccggc
ggcctcggacacatcgccgtccagtacgccgtcgccatgggcatgcgcgtcatcgccgtc
gacatcgccgacgacaagctcgagctggccaagcgccacggcgcggagttcaccgtgaac
gccaagcactccgacccggcggaggccgtccaggaatacaccggcggcggcgcgcacggc
gtcctcgtcaccgcggtccacgaggcggcgttcggccaggccatcggcatggcccgcaag
ggcggcaccatcgtgttcaacggcctgccgccgggggacttcccggcccccatcttcgag
atcgtgttcaaggcgctgacgatccgtggttcgctcgtcggcacccgccaggatctcgag
gaggcgctcgacttctacgcccgtggcatgatcaagccgaccgtgcacgagtgctccctc
gacgacgtcaactccgtcttcgaggacatgcgccacggcaagatcgaggggcgcatgtcc
atcaagtactga

DBGET integrated database retrieval system