KEGG   Corynebacterium resistens: CRES_1177Help
Entry
CRES_1177         CDS       T01538                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
crd  Corynebacterium resistens
Pathway
crd00010  Glycolysis / Gluconeogenesis
crd00520  Amino sugar and nucleotide sugar metabolism
crd01100  Metabolic pathways
crd01110  Biosynthesis of secondary metabolites
crd01120  Microbial metabolism in diverse environments
crd01130  Biosynthesis of antibiotics
crd01200  Carbon metabolism
Module
crd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CRES_1177 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    CRES_1177 (ppgK)
Enzymes [BR:crd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CRES_1177 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N DUF3126 DUF4445
Motif
Other DBs
NCBI-ProteinID: AEI09532
UniProt: F8DXM3
Position
1427106..1427870
Genome map
AA seq 254 aa AA seqDB search
MTEHNSDLSFGVDIGGSGVKAAVVDMKTGEFVTERLKIATPQPANPDAVAEVVKELMEEA
DWNGPVGITVPAVVKNQITRSAANIGGDWIGTDCQELFRKHLGNREIAVLNDADAAGLAE
VAYGDEQARSGSVMLLTFGTGIGSALLMDGNLYPNSELGHLPFGHTSCEKWASSAVKEKE
DLSFKEWAKRVDQVMHEYARLFSPQTFVVGGGISRKADKWVPLLTVEQKVVPAQLRNKAG
IVGAAMAVRDGFRP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcacaactctgatttgagctttggtgtcgatattggcggttcgggcgttaaa
gctgccgtggtcgatatgaaaaccggtgaattcgtcactgaaaggttgaagattgcaacc
cctcagcccgcgaaccccgacgcggtagcggaagtcgttaaggagctcatggaggaagcc
gactggaacggaccagtgggtattacggtgccggcggtagtaaagaatcagattacgcgc
agtgctgcgaatattggtggggactggatcggtaccgattgccaggaattattccgcaaa
cacttgggtaatcgtgagatcgcggtacttaatgatgcggatgccgcgggcctagccgaa
gtggcttatggcgatgagcaggcacgcagcggatctgtcatgctgttgacgtttgggacc
ggcattggatccgcactactcatggacggaaatctgtacccgaattcagaactggggcat
ctgccgtttggccacacttcttgcgagaagtgggcgagctccgcagtcaaagagaaggaa
gacttaagcttcaaagagtgggcgaaacgtgtcgatcaagtcatgcacgaatacgcgagg
ctttttagccctcaaacattcgtcgtaggcggtggaatttctcgtaaggccgataagtgg
gtgccacttcttaccgtcgagcagaaagtcgtccccgcacagcttcgaaataaagcagga
attgtgggggcggcgatggccgtccgggatgggttccgtccttaa

DBGET integrated database retrieval system