KEGG   Corynebacterium resistens: CRES_1382Help
Entry
CRES_1382         CDS       T01538                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
crd  Corynebacterium resistens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:crd01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:crd01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:crd00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:crd00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:crd00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:crd00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:crd00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1676128..1677186)
Genome map
AA seq 352 aa AA seqDB search
MSGAVATIATMRIATLTSGGDCPGLNAVIRAVVRTAAQHGSTVVGYEDGWQGLLEDRRVQ
LYDDAFIDRILRQGGTILGTGRLHPDAFKAGIDRVKANLADAQIDALIAIGGEGTLKGAK
WLHDNGVPVVGVPKTIDNDVDGTDYTFGFDTAVAVATEAIDRLHTTAESHNRVMIVEVMG
RHVGWIALHAGMAGGAHEILIPEAPFDIDDVCKRMARRFQLGEKYGIIVVAEGALPKKGT
LDVGEREVDQFGHEKFQDISGMIAKELENRLDTDVRTTVLGHTQRGGTPTAFDRVLATRF
GVNAAQACLNGDFGKVVALQASHIDLISFDDAVGELKRVPPKFYETAQALFG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgggggcggtcgctacaatcgcgactatgcgtattgcgaccctcaccagtggtgga
gactgcccaggactcaatgccgttattcgtgccgtcgtgcgtacggctgcccagcacggt
tcgactgtcgtcggttatgaagacggttggcaagggctgcttgaggaccggcgcgtgcaa
ctctacgacgatgcatttattgatcggattctgcgccaaggtggcacaattttgggcacc
gggcgccttcatcccgatgccttcaaggcaggcatcgatcgtgtcaaggcgaacctagcg
gatgcacaaattgatgcgctcatcgccatcggtggtgaaggaacgcttaagggagctaag
tggctgcacgataatggtgtgccggttgtgggagttccgaagaccattgacaatgacgtc
gatgggacggattacaccttcggcttcgatacggccgtggcagtggcgaccgaggccatc
gaccggctgcacaccaccgcggaatcccataaccgagtgatgatcgtggaggtcatggga
cgacacgtcggttggatcgcattgcatgctggtatggccggtggtgcgcatgagatcctc
atcccagaagcacctttcgacattgatgatgtctgtaaacgaatggctcgccggttccag
ttgggggagaagtacggcatcatcgttgtcgctgagggggcgttgcccaagaagggcaca
ctggatgtgggcgagcgcgaagttgaccagttcgggcacgaaaagttccaagacatttcg
ggcatgatcgccaaggaattggaaaaccgtttggataccgacgtgcgcacaacagtgctt
gggcacacccaacgtggcggaactcccacggcttttgatcgagtgttggctactcgcttc
ggcgtcaacgccgcgcaagcatgtctgaatggagactttggcaaggtcgtcgcattgcaa
gcctcccacattgacttgatttccttcgatgatgcagtgggggaactcaagcgggttcca
cctaagttctacgaaactgcgcaggcgctgttcggctag

DBGET integrated database retrieval system