KEGG   Corynebacterium resistens: CRES_1382Help
Entry
CRES_1382         CDS       T01538                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
crd  Corynebacterium resistens
Pathway
crd00010  Glycolysis / Gluconeogenesis
crd00030  Pentose phosphate pathway
crd00051  Fructose and mannose metabolism
crd00052  Galactose metabolism
crd00680  Methane metabolism
crd01100  Metabolic pathways
crd01110  Biosynthesis of secondary metabolites
crd01120  Microbial metabolism in diverse environments
crd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CRES_1382 (pfkA)
   00030 Pentose phosphate pathway
    CRES_1382 (pfkA)
   00051 Fructose and mannose metabolism
    CRES_1382 (pfkA)
   00052 Galactose metabolism
    CRES_1382 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CRES_1382 (pfkA)
Enzymes [BR:crd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CRES_1382 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CRES_1382 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEI09737
UniProt: F8DYZ2
Position
complement(1676128..1677186)
Genome map
AA seq 352 aa AA seqDB search
MSGAVATIATMRIATLTSGGDCPGLNAVIRAVVRTAAQHGSTVVGYEDGWQGLLEDRRVQ
LYDDAFIDRILRQGGTILGTGRLHPDAFKAGIDRVKANLADAQIDALIAIGGEGTLKGAK
WLHDNGVPVVGVPKTIDNDVDGTDYTFGFDTAVAVATEAIDRLHTTAESHNRVMIVEVMG
RHVGWIALHAGMAGGAHEILIPEAPFDIDDVCKRMARRFQLGEKYGIIVVAEGALPKKGT
LDVGEREVDQFGHEKFQDISGMIAKELENRLDTDVRTTVLGHTQRGGTPTAFDRVLATRF
GVNAAQACLNGDFGKVVALQASHIDLISFDDAVGELKRVPPKFYETAQALFG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgggggcggtcgctacaatcgcgactatgcgtattgcgaccctcaccagtggtgga
gactgcccaggactcaatgccgttattcgtgccgtcgtgcgtacggctgcccagcacggt
tcgactgtcgtcggttatgaagacggttggcaagggctgcttgaggaccggcgcgtgcaa
ctctacgacgatgcatttattgatcggattctgcgccaaggtggcacaattttgggcacc
gggcgccttcatcccgatgccttcaaggcaggcatcgatcgtgtcaaggcgaacctagcg
gatgcacaaattgatgcgctcatcgccatcggtggtgaaggaacgcttaagggagctaag
tggctgcacgataatggtgtgccggttgtgggagttccgaagaccattgacaatgacgtc
gatgggacggattacaccttcggcttcgatacggccgtggcagtggcgaccgaggccatc
gaccggctgcacaccaccgcggaatcccataaccgagtgatgatcgtggaggtcatggga
cgacacgtcggttggatcgcattgcatgctggtatggccggtggtgcgcatgagatcctc
atcccagaagcacctttcgacattgatgatgtctgtaaacgaatggctcgccggttccag
ttgggggagaagtacggcatcatcgttgtcgctgagggggcgttgcccaagaagggcaca
ctggatgtgggcgagcgcgaagttgaccagttcgggcacgaaaagttccaagacatttcg
ggcatgatcgccaaggaattggaaaaccgtttggataccgacgtgcgcacaacagtgctt
gggcacacccaacgtggcggaactcccacggcttttgatcgagtgttggctactcgcttc
ggcgtcaacgccgcgcaagcatgtctgaatggagactttggcaaggtcgtcgcattgcaa
gcctcccacattgacttgatttccttcgatgatgcagtgggggaactcaagcgggttcca
cctaagttctacgaaactgcgcaggcgctgttcggctag

DBGET integrated database retrieval system