KEGG   Corynebacterium resistens: CRES_1659Help
Entry
CRES_1659         CDS       T01538                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
crd  Corynebacterium resistens
Pathway
crd00040  Pentose and glucuronate interconversions
crd00052  Galactose metabolism
crd00500  Starch and sucrose metabolism
crd00520  Amino sugar and nucleotide sugar metabolism
crd01100  Metabolic pathways
crd01130  Biosynthesis of antibiotics
Module
crd_M00362  Nucleotide sugar biosynthesis, prokaryotes
crd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CRES_1659 (galU)
   00052 Galactose metabolism
    CRES_1659 (galU)
   00500 Starch and sucrose metabolism
    CRES_1659 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CRES_1659 (galU)
Enzymes [BR:crd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CRES_1659 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEI10012
UniProt: F8E0M2
Position
complement(1983094..1984017)
Genome map
AA seq 307 aa AA seqDB search
MSSTPTTDQNNAPAHVRTVVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELIAKEAAAA
GADRLAIITAPKKDGIMAHFRTDAELEETLEARDKQDQLTKVRAVDGLINAVPVEQEKPL
GLGHAIGLAESVLDEDEDCFAVMLPDDLVLPFGAMEQMLAIRQRFGGSVLCAFEVPREDV
SKYGVFDIEESSEENVKAVKAMVEKPDVDEAPSNFVATGRYLLDRQIFDALRRTKPGKGG
EIQITDAIELLIEEGHPVHILVHHGQRHDLGNPGGYIRACVDFALQDDTYGPSLRRWLEE
RLATNES
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctacccctacgactgatcaaaacaatgcgccggcacatgtgcgtaccgtggtt
gttcccgcagctggcctaggaacccgattccttcccgcgactaagacagttcccaaagag
ctgctcccggtcgtagacactccgggtattgaactcattgctaaagaagcagctgctgct
ggcgcggatcgtctagccatcatcaccgccccaaagaaggacggcatcatggcgcacttt
cgcacggatgcggaattggaagaaacccttgaagcgcgtgacaagcaagatcaactgacc
aaggttcgcgcagtagatggactcatcaacgctgtacccgtcgaacaggaaaagcctctc
gggctcgggcacgccatcggtcttgcggaatccgttctcgacgaagatgaggattgcttc
gccgttatgcttcccgatgatctcgtcttgccgttcggcgccatggagcaaatgctcgct
attcgccagaggttcggtggatcggtcttgtgcgctttcgaggttccacgggaagatgtc
agcaagtatggcgtgtttgatatcgaggaatcgagcgaagaaaacgttaaggccgtcaag
gcgatggtagaaaagcctgacgttgacgaggcaccaagtaatttcgtagccaccggtcga
tacttgctggaccgtcagattttcgacgcccttcgccgcactaagcctggtaagggtggg
gaaattcagatcactgatgcgatcgagttgctcatcgaagaaggccaccctgtgcatatt
ctcgttcaccatgggcagcgccacgatctgggtaatcccggtggatacattcgcgcctgt
gtggacttcgcgcttcaagacgacacctacggcccgtccctgcgccggtggctcgaagaa
cgcttggctacaaacgaaagctag

DBGET integrated database retrieval system