KEGG   Corynebacterium resistens: CRES_1949Help
Entry
CRES_1949         CDS       T01538                                 

Gene name
hemD
Definition
uroporphyrin-III C-methyltransferase / uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
crd  Corynebacterium resistens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:crd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2311015..2312853)
Genome map
AA seq 612 aa AA seqDB search
MHPARVAKIESRTDMTVSGMDPVGQQGRVLFVGAGPGNPELLTVRARDVIEHTAYAWVDP
AVLNGVQSLIAAKVPVPQHKLDAAEKEWEQRVAAAREAGARRRPPRPEPPTAAEIVFAAP
GAAVDADGDDADEAATAATEGGEDSAAVMVPADPVVIAQQMVACAKAGNDVIRLVAGNPL
STPGVLLELQEVENLGVEFQVVPGMTGSVAVPAFTGIRVGPDVTTADVRGGTDWDQLAGA
GLPLILTAAPSDLMGIASELKARSIPGSTPATVTLHGTTRRQRSYDVTLDTLKSIAAASG
PAAKEGELPDELIVTIGSEVGNRSKYSWWENRALYGWTVLVPRAKNQAGPMSARLASHGA
IPVEVPTISVEPPRTPVQMERAIKGIVDGHYHWVVFTSVNAVKATWEKLQEFGLDARALA
GVRVAAVGPKTAQSVLDLGITPELLPKDNARNASGLVDVFPAYDPDVDMVDKVLLPRADI
ATDVLVDGLIDLGWDVEDVVAYRTVRAAPPSPEIRDMIKTGGFDAVCFTSSSTVKNLVGI
AGKPHARTIIACIGPMAAQTAREHGLRVDVMPEAAGVPELVDALAEHVADLRAKGQLPPP
RKRRRRRKKTSS
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
gtgcatccagcacgggtagcgaaaatagaaagccgtaccgacatgactgtttccggaatg
gaccctgtgggtcagcagggccgagtgctctttgtgggtgccggcccaggtaacccggaa
ttgctgaccgtccgcgcacgcgacgtcatcgaacacaccgcttatgcctgggtggatcca
gcggtgctcaacggagtgcagtccctgattgctgccaaagtgcccgtgcctcagcacaag
ctggatgctgcagaaaaggaatgggaacagcgcgtggctgctgcgcgcgaagccggtgct
cgtcggcgtccaccgcgaccggagcctccaacggcggcggagatcgtttttgcggcgccg
ggcgctgcggtggatgccgatggggatgacgccgatgaggccgcaaccgccgctaccgag
ggtggcgaagactcggccgccgtcatggtcccagctgatccggtggttatcgctcagcaa
atggtcgcgtgtgcgaaggccggcaacgatgttattcgcctagtggctggcaacccgttg
agcacgccgggggttttgctggagctgcaagaggtagagaacctgggcgtagagttccaa
gtcgtacctggcatgactgggtctgtggcggtacccgcgtttaccggtatccgtgtcggg
ccagatgtgaccactgccgatgtgcgaggaggaacggattgggatcagctcgccggtgcc
ggcttaccgttgatcctcactgctgcgccaagcgacttgatgggcattgcctcggagttg
aaggcgcgtagcatcccgggctccactccggcgacagtaactttgcacggcacgacccgt
cgccagcgtagctacgatgtcacgctggatacgctgaagtcgatcgctgctgcttccggg
cccgctgctaaggaaggcgagctcccagacgaacttatcgtcacgatcggtagtgaagtt
ggcaatcgctccaagtactcgtggtgggaaaatcgcgcgctgtatggatggaccgttcta
gtcccccgtgcgaaaaaccaagctgggccgatgagcgcccgtttggcctcccatggtgca
attccagtggaggtgcccacgatctccgtggagccacctcgcacacctgttcagatggaa
cgtgcgatcaaggggatcgtggatgggcactatcactgggtggtgttcaccagcgttaac
gcagtgaaggctacgtgggagaagctccaggagtttggcctcgatgcccgagccctcgcc
ggagtacgcgtggcggctgtggggccgaagaccgcacaatccgtcctcgacctcggtatc
accccagagctgttgccaaaggataatgcgcgcaacgcttcgggcttggtggacgttttc
cctgcttacgatcctgacgtggacatggtggataaggttttgctgccacgtgccgatatc
gccacggacgtgctcgtcgatggcctcatcgaccttggctgggatgtggaagatgtcgtg
gcctaccgcaccgtgcgggcggccccgccgagccccgagattcgcgacatgatcaagacc
ggtggcttcgacgcagtctgcttcacgtcctcttcgaccgtcaaaaatctcgtcggcatc
gcgggtaagccacatgcgcgcaccatcattgcttgcatcggaccgatggcagcccaaacc
gcgcgtgaacatggcctccgcgtggatgtcatgcccgaagcggccggggtaccggagctc
gtggacgcactagcggagcatgtggccgatctgcgcgcgaagggccagctgccacctcct
cggaagaggcggcgtcggaggaagaaaacctccagctaa

DBGET integrated database retrieval system