KEGG   Corynebacterium resistens: CRES_1959Help
Entry
CRES_1959         CDS       T01538                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
crd  Corynebacterium resistens
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CRES_1959 (gpmA)
   01230 Biosynthesis of amino acids
    CRES_1959 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CRES_1959 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CRES_1959 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CRES_1959 (gpmA)
Enzymes [BR:crd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CRES_1959 (gpmA)
Exosome [BR:crd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CRES_1959 (gpmA)
  Exosomal proteins of melanoma cells
   CRES_1959 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2324304..2325101)
Genome map
AA seq 265 aa AA seqDB search
MWHYRVMTEQNSLNKPSEARGTLILLRHGQSEWNASNQFTGWVDVALTEKGRQEAVRGGE
MLKEAGLEPNVLYTSLLRRAITTAALALDAADRHWIPVIRDWRLNERHYGALQGLNKAET
KDKYGEDQFMSWRRSYDTPPPAIEPDNEYAQTNDPRYADLAEIPRTECLLDVVKRFIPYY
KEEIEPRLNNGETVLVAAHGNSLRALVKHLDNISDEDIAGLNIPTGIPLVYFTDANGKVL
NPGGNYLDPEAAAAGAAAVAAQGEK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtggcactatagagttatgactgagcaaaactccttgaataagccatcggaagctcgc
ggcacactgatcctgctgcgacacggccaatctgagtggaacgcgtccaaccagttcacc
ggttgggttgacgttgcgttgaccgagaagggtcgtcaagaagccgttcgcggcggtgag
atgctgaaggaagcgggcctagagcccaacgtcttgtacacttccttgctgcgtcgcgcg
attacgacggcggcgttggccctagatgccgctgatcgccactggattccggttatccgc
gattggcgcctaaacgagcgccactacggtgcgctgcaggggctgaacaaggcggagacc
aaggacaagtacggcgaagatcagttcatgagctggcgccgttcctacgacaccccaccg
ccagccattgagccagataacgagtacgcccagaccaacgatccacgctacgcggatcta
gcagaaatcccacgcaccgagtgcctgctggatgtagtcaagcgcttcatcccttactac
aaagaagaaatcgagccacgcctgaacaacggcgagactgtgctggtcgcggctcacggc
aactccctgcgcgcgctggtcaagcacttggacaacatcagcgacgaagacatcgccggc
ctgaacatcccaactggcatcccgcttgtttacttcaccgacgccaacggcaaggtcctt
aacccaggtggcaattacctggatcccgaagctgcggctgcaggagcggctgccgttgcg
gctcagggtgagaagtaa

DBGET integrated database retrieval system