KEGG   Corynebacterium resistens: CRES_1959Help
Entry
CRES_1959         CDS       T01538                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
crd  Corynebacterium resistens
Pathway
crd00010  Glycolysis / Gluconeogenesis
crd00260  Glycine, serine and threonine metabolism
crd00680  Methane metabolism
crd01100  Metabolic pathways
crd01110  Biosynthesis of secondary metabolites
crd01120  Microbial metabolism in diverse environments
crd01130  Biosynthesis of antibiotics
crd01200  Carbon metabolism
crd01230  Biosynthesis of amino acids
Module
crd_M00002  Glycolysis, core module involving three-carbon compounds
crd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CRES_1959 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CRES_1959 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CRES_1959 (gpmA)
Enzymes [BR:crd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CRES_1959 (gpmA)
Membrane trafficking [BR:crd04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CRES_1959 (gpmA)
Exosome [BR:crd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CRES_1959 (gpmA)
  Exosomal proteins of melanoma cells
   CRES_1959 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEI10312
UniProt: F8E340
Position
complement(2324304..2325101)
Genome map
AA seq 265 aa AA seqDB search
MWHYRVMTEQNSLNKPSEARGTLILLRHGQSEWNASNQFTGWVDVALTEKGRQEAVRGGE
MLKEAGLEPNVLYTSLLRRAITTAALALDAADRHWIPVIRDWRLNERHYGALQGLNKAET
KDKYGEDQFMSWRRSYDTPPPAIEPDNEYAQTNDPRYADLAEIPRTECLLDVVKRFIPYY
KEEIEPRLNNGETVLVAAHGNSLRALVKHLDNISDEDIAGLNIPTGIPLVYFTDANGKVL
NPGGNYLDPEAAAAGAAAVAAQGEK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtggcactatagagttatgactgagcaaaactccttgaataagccatcggaagctcgc
ggcacactgatcctgctgcgacacggccaatctgagtggaacgcgtccaaccagttcacc
ggttgggttgacgttgcgttgaccgagaagggtcgtcaagaagccgttcgcggcggtgag
atgctgaaggaagcgggcctagagcccaacgtcttgtacacttccttgctgcgtcgcgcg
attacgacggcggcgttggccctagatgccgctgatcgccactggattccggttatccgc
gattggcgcctaaacgagcgccactacggtgcgctgcaggggctgaacaaggcggagacc
aaggacaagtacggcgaagatcagttcatgagctggcgccgttcctacgacaccccaccg
ccagccattgagccagataacgagtacgcccagaccaacgatccacgctacgcggatcta
gcagaaatcccacgcaccgagtgcctgctggatgtagtcaagcgcttcatcccttactac
aaagaagaaatcgagccacgcctgaacaacggcgagactgtgctggtcgcggctcacggc
aactccctgcgcgcgctggtcaagcacttggacaacatcagcgacgaagacatcgccggc
ctgaacatcccaactggcatcccgcttgtttacttcaccgacgccaacggcaaggtcctt
aacccaggtggcaattacctggatcccgaagctgcggctgcaggagcggctgccgttgcg
gctcagggtgagaagtaa

DBGET integrated database retrieval system