KEGG   Corynebacterium resistens: CRES_1978Help
Entry
CRES_1978         CDS       T01538                                 

Gene name
aceB
Definition
(RefSeq) Malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
crd  Corynebacterium resistens
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CRES_1978 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CRES_1978 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    CRES_1978 (aceB)
Enzymes [BR:crd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CRES_1978 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2345090..2347312)
Genome map
AA seq 740 aa AA seqDB search
MTIDQKTERISAGGLQVAKTLYDFVNGEVLPRVGKDSAEDQKQFWDGFGKIVEDFTPRNR
ELLAKRDEFQQKLDDWYSNHAGEQNAEEYTAFLKEIGYLVDAPADFKINTENIDTEISET
AGPQLVVPVLNARFAINAANARWGSLYDALYGTNAISEEDGAEKGTGYNKVRGDKVIAWS
RDFLDRAVPLESGSHKDVTKYSVASGQFTAEIDGQEVRLREPDVYAGYAGEEANPTSILL
RNNGLYIDIQIDPESPVGSTDKAGVKDIILESAVSTIMDFEDSVAAVDATDKTLGYRNWF
GLNTGELSEEVTKGDRTFTRRMNPDREYTSRDGEKLRLHGRSLLFVRNVGHLMQNPAILD
QNGEEIFEGIMDGVITSACAIPGLEESNERGNSRTGSIYIVKPKQHGPEEVAFTNDLFAA
IEDLLGLQRYTLKVGVMDEERRTSVNLDACIAAVKDRLAFINTGFLDRTGDEIHTSMVAG
PMIRKGEMKQSKWMLAYEDNNVDAGLEHGLPGKAQIGKGMWAMTELMAEMLEQKIGQPKQ
GASTAWVPSPTGATLHATHYHEVDVFAVQEKLHTEGRRETQADLLTVPVAGAAKGEGAAT
WDEAEIKEELDNNCQSILGYVVRWVEQGVGCSKVPDIHDIDLMEDRATLRISSQLLANWL
KHGVISEDQVIESLERMAKKVDAQNAGDSAYRDMAANYDESVAFQAAKDLILKGEEQPSG
YTEPILHARRREFKAKNGIA
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgaccagaagactgagcgcatttctgcaggcggactgcaggtcgccaagact
ctctacgactttgtcaacggtgaagttcttccacgggtcggtaaggattccgcagaggat
cagaagcagttctgggatggcttcggcaagatcgtcgaagatttcaccccacgcaaccgc
gagctgctcgccaagcgcgatgaattccagcagaagctggatgattggtactccaaccac
gccggcgagcagaacgcagaggagtacactgcattcctcaaggagatcggctacctcgtc
gatgctcctgcggacttcaagatcaacacggaaaatatcgataccgagatttccgagacc
gctggcccgcagctggtcgttccagtccttaatgcccgtttcgcgattaacgctgccaat
gctcgttggggatctttgtatgacgccctgtacggcacgaatgctatttctgaagaggac
ggcgcagagaagggcactggctataacaaggtccgtggcgacaaggtcatcgcttggtcc
cgtgatttccttgaccgcgcagtgcctctggaatccggctcccataaggatgtcaccaag
tactcggtagcttcgggccaattcaccgctgagatcgatggtcaggaagtacgcttgcgc
gagcctgacgtttacgcaggttacgccggcgaagaggctaacccgacctccattcttctg
cgtaacaatggcttgtacatcgatattcagatcgatcctgaatctccagtcggctccacc
gacaaggcaggggtgaaggacatcatcctcgagtccgcagtttctaccatcatggacttc
gaagactcggtggcagctgtcgatgccaccgacaaaacactcggataccgcaactggttc
ggcctgaacaccggcgagctctccgaagaggtcacgaagggggataggactttcactcgt
cgcatgaatcctgaccgcgagtacacctctcgcgatggtgagaagctgcgcttgcatggc
cgctccttgctcttcgtgcgtaacgttggccacctcatgcagaacccagccatcttggac
cagaacggggaggagatcttcgaaggcatcatggatggtgttatcacctctgcgtgtgcc
atccctggccttgaagaatccaatgagcgtggcaactcccgcaccggttccatctacatc
gtgaagcccaagcagcacggcccagaagaagttgctttcaccaatgacctcttcgctgcg
attgaggacttgcttggcttgcagcgttacacgctgaaggtcggcgtcatggatgaggag
cgccgcacttccgtaaacctcgatgcttgcatcgccgcagtgaaggatcgcctagctttc
attaacacgggcttcttggatcgcacgggtgatgagatccacacctccatggtggctggc
ccaatgatccgcaagggcgagatgaagcaatccaagtggatgctcgcctacgaggacaac
aacgtggatgctggtctggagcacggcctgcccggtaaggcacagatcggcaagggaatg
tgggcaatgaccgagctcatggcagagatgctcgagcagaagattggtcagccgaagcag
ggggcttctaccgcatgggtgccttcgccaaccggcgctacgctgcacgccacccactac
cacgaggtggatgtcttcgctgtccaggagaagctgcacacggaaggtcgtcgtgagacc
caagctgacctgctgactgttcctgtagcgggtgctgcaaagggcgagggtgccgctacg
tgggacgaggccgagattaaggaagagctggacaacaactgccagtccatcttgggctac
gtggtgcgttgggttgagcagggcgtgggctgctccaaggttcccgatattcacgacatt
gacctgatggaggaccgcgctaccttgcgtatttcctcccagctcttggccaactggctc
aagcacggtgtgatcagcgaagaccaggtcatcgaatccctagagcgcatggctaagaag
gtcgacgcacagaacgctggagactcggcttaccgcgacatggctgcgaactacgatgag
tccgttgcattccaagctgcgaaggatctcatcttgaagggcgaggagcagccttccggc
tacaccgagccgatcctgcacgctcgccgtcgcgagttcaaggcgaagaacggtatcgcc
taa

DBGET integrated database retrieval system