KEGG   Corynebacterium resistens: CRES_2063Help
Entry
CRES_2063         CDS       T01538                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
crd  Corynebacterium resistens
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:crd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2445071..2445727)
Genome map
AA seq 218 aa AA seqDB search
MFEGPLQDVIDEFSRLPGIGPKSAQRIALHLMEVEAEDLKRFQAALGRLQDGVAFCRICH
NISQEDICRICADSSRDKSIICVVEESKDIQVIERTAEYRGRYHVLGGALDPLAGVGPKE
LNVTPLVQRIGGVLNDVARPGEGDEVVYDPAPEIEEVIIATDPNTEGEATASYLGRLLKD
FPGLKVTRLASGIPMGGDLEFVDELTLSRAFAGRTALG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgaaggaccgctgcaggacgtcatcgacgagttctcgcgcctacccggcatcggc
cccaagagcgcgcagcgcattgcactgcacctcatggaggttgaggcggaagatttgaaa
cgcttccaagctgcgctcggtaggttgcaagacggggtggcgttttgccgtatttgccac
aacatttcgcaggaggatatctgccgcatttgcgcggattcctcgcgcgataaatccatc
atttgtgtggtggaggaatccaaggacatccaagttatcgagcgcacggctgagtacaga
ggccggtatcacgtgctcggcggagccttagaccccctggcgggcgtgggccctaaggaa
ttgaatgtgacgccattggtccaacgcatcggtggtgtactcaacgacgtggcccgtcca
ggcgagggcgacgaggtggtttatgaccctgctccggagatcgaggaagtgatcatcgcc
accgatccgaatacggagggcgaggcgaccgccagttatttgggcaggttgctcaaggac
ttccctgggttgaaggtgacccgcttggcttcgggtattccgatgggtggagatttggag
ttcgtcgacgagcttactctttcccgcgccttcgctggacgcaccgcgctgggctag

DBGET integrated database retrieval system