KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_100162Help
Entry
CHLREDRAFT_100162 CDS       T01039                                 

Gene name
HTB18
Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
cre  Chlamydomonas reinhardtii
Brite
Exosome [BR:cre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CHLREDRAFT_100162 (HTB18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 153 aa AA seqDB search
MAPKKDEKPATQEAAAEAPAKAEAKPKAEKAAKKAKKEPSKKAAKEPKGDGEKKDKKKKK
SAVETYKLYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEKVATEASKLSRYNKKPTVTS
REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagaaggacgagaagcccgcgactcaggaggctgccgctgaggcccctgcc
aaggccgaggccaagcccaaggccgagaaggccgccaagaaggccaagaaggagccctcc
aagaaggctgccaaggagcccaagggcgatggcgagaagaaggacaagaagaagaagaag
agcgccgtggagacctacaagctgtacatctacaaggtgctcaagcaggtgcaccccgac
actggcatcagcagcaaggccatgtccatcatgaacagcttcatcaacgacatctttgag
aaggtggccaccgaggcctccaagctgagccgctacaacaagaagcccaccgtgacctcc
cgcgagatccagaccgctgtgcgcctggtgctgcccggcgagctggccaagcacgcggtg
tcggagggcaccaaggccgtgaccaagttcacctcgggctaa

DBGET integrated database retrieval system