KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_103296Help
Entry
CHLREDRAFT_103296 CDS       T01039                                 

Gene name
FAP121
Definition
flagellar associated protein (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cre00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 172 aa AA seqDB search
MLVVCGPSGVGKGTLIGRLMAEHGDKFGFSVSHTTRGPRPGEQDGVHYHFTDMASMTSEV
ESGMFLEHAAVHGNMYGTSLAAVAAVGRGGRVAVLDIDVQVGLVHAVYVFVDPPSMQELE
ARLRGRGTETEDKVQLRLKNSTAEIERSHEPGFFDARIVNDDLDAAYHRFKL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgctggtggtgtgcggccccagcggcgtgggcaagggcacgctgatcgggcggctgatg
gcggagcacggcgacaagttcggcttcagcgtcagccacaccactcgcgggccgcgcccc
ggcgagcaggacggagtgcactaccacttcaccgacatggcgtccatgacgagcgaggtg
gagtcaggaatgttcctggagcacgcagcggtgcacggcaacatgtacggcaccagcctg
gcggcggtggcggcggtggggcgcggcggccgcgtggcggtgctggacatcgacgtgcag
gtgggtttggtgcatgccgtgtacgtgttcgtggacccgccctccatgcaagagctggag
gcgcggctgcgcggccgaggcaccgagacggaggacaaggtgcagctgcgcctgaagaac
tccaccgccgagatcgagcgctcccacgagcccggcttcttcgacgcccgcatcgtcaat
gacgacctggacgccgcctaccaccgcttcaagctc

DBGET integrated database retrieval system