KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_104855Help
Entry
CHLREDRAFT_104855 CDS       T01039                                 

Definition
histone deacetylase
Orthology
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CHLREDRAFT_104855
Protein phosphatases and associated proteins [BR:cre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CHLREDRAFT_104855
Messenger RNA biogenesis [BR:cre03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     CHLREDRAFT_104855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 223 aa AA seqDB search
LAAGSAAEVARRVCSGAARHGAAIIRPPGHHAESSVAMGFCYYNNAAVAARAAQAAGARR
VVVMDWDVHHGNGTQRILYDDPSVLYMSTHRYDHGTYYPGTGDASEVGVGAGEGFTVNVP
WNCSGVRDADMLAAFRHVILPIASEFRPDLVIVSAGFDAVEGDPLGGCRVSPAAFGHFTA
LLSALAPSVLLLEGGYNLSATAAATEACLRVLLGEAPQELSAP
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ctggccgccggcagcgccgccgaggtggcgcgccgcgtgtgctccggcgccgcccgccac
ggtgccgccatcatccggccgccaggccaccacgccgagagctcagtggccatgggcttc
tgctactacaacaacgcggcggtggcggcgcgcgccgcgcaggcggcgggcgcgcggcgg
gtggtggtgatggattgggacgtgcaccacggcaacggcacgcagcgcatcctgtacgac
gaccccagcgtgctgtacatgtccacccaccgctacgaccacggcacctactaccccgga
accggcgacgcaagcgaggtgggcgtgggcgcgggcgagggcttcaccgtcaacgtgccc
tggaactgcagcggcgtgcgcgacgccgacatgctcgccgccttccgccacgtcatcctg
cccatcgcctccgagttccgccccgacctggtcatcgtgtccgccggcttcgacgccgtt
gagggtgacccgctgggcggctgccgcgtcagccccgccgccttcggccactttacggcg
ctgctgtccgcgctagcgccgtcggtgctgctgctggagggcggctacaacctttcggcc
accgccgccgccaccgaggcctgcctgcgcgtgctgctgggcgaggcgccgcaggagctg
tccgcgccg

DBGET integrated database retrieval system