KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_106184Help
Entry
CHLREDRAFT_106184 CDS       T01039                                 

Definition
(RefSeq) predicted protein
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CHLREDRAFT_106184
Protein kinases [BR:cre01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   CHLREDRAFT_106184
Membrane trafficking [BR:cre04131]
 Autophagy
  Other autophagy associated proteins
   Others
    CHLREDRAFT_106184
Mitochondrial biogenesis [BR:cre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    CHLREDRAFT_106184
  Mitophagy factors
   Other mitophagy factors
    CHLREDRAFT_106184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like UBA Haspin_kinase YukC UBA_2 ABC1 APH
Motif
Other DBs
NCBI-GeneID: 5724222
NCBI-ProteinID: XP_001698727
JGI: 106184
UniProt: A8J9W4
Position
Unknown
AA seq 317 aa AA seqDB search
GYNQSAEFFLSNYRLGKTLGIGSFGKVKVAEHVLTGHKVAIKILNRRKIQQMEMEEKVRR
EIKILRLFMHPHIIRLYEVIETPSDIYVVMEYVKVRRGWGVWEGGGRVCAYGGGYCHRNM
VVHRDLKPENLLLDAKMNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPE
VDVWSCGVILYALLCGSLPFDDENIPNLFKKIKGGIYNLPSHLSPGARDLIPRMLLVDPL
KRITIPEIRQHPWFNMHLPRYLAVMQAEPVVGVPRIDEEILEEVVRLGFDRDGLLDSLRS
RAANKATVTYYLMTDNR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ggatacaaccagagtgcggagttcttcctcagcaattaccggctagggaaaacactcggc
attggttcctttggcaaggtcaaggtcgcggagcatgtgctcacggggcacaaggtggcg
attaagatcctcaaccggcgtaaaatccagcagatggagatggaggagaaagtccgtcgt
gagatcaagatcctgcggctgttcatgcacccgcacatcatccggctgtatgaggtgatc
gagacgccgtctgatatctacgtggtcatggagtacgtcaaggtgaggaggggatggggg
gtttgggagggaggagggcgtgtgtgtgcatatgggggggggtactgccaccgcaacatg
gtggtccaccgcgacctcaagcccgagaacctgctgctggacgccaagatgaacgtcaag
atcgcggactttggcctgtccaacatcatgcgcgacggccacttcctcaaaaccagctgc
ggctcgcccaactacgccgcgcccgaggtgattagcggcaagctgtatgcgggcccggag
gtggacgtgtggagctgcggcgtcattctgtacgcgctgttgtgtggatcactgcccttt
gacgacgagaacatccccaacctgttcaagaagatcaagggcggcatctacaacctgccc
tcacacctcagcccgggcgcgcgcgacctgatcccgcgcatgctgctggtggacccgctc
aagcgcatcaccatccccgagatccggcagcacccctggttcaacatgcacctgccgcga
tacctggccgtcatgcaggccgagccggtggtgggcgtgccgcgcattgatgaggagatc
ctggaggaggtggtgcggctgggctttgaccgggacgggcttctggactcgctgcgcagc
cgcgccgccaacaaggccaccgtcacctactacctcatgactgacaacagg

DBGET integrated database retrieval system