KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_106184Help
Entry
CHLREDRAFT_106184 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:cre00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    CHLREDRAFT_106184
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CHLREDRAFT_106184
Protein kinases [BR:cre01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   CHLREDRAFT_106184
Mitochondrial biogenesis [BR:cre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    CHLREDRAFT_106184
  Mitophagy factors
   Other mitophagy factors
    CHLREDRAFT_106184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 317 aa AA seqDB search
GYNQSAEFFLSNYRLGKTLGIGSFGKVKVAEHVLTGHKVAIKILNRRKIQQMEMEEKVRR
EIKILRLFMHPHIIRLYEVIETPSDIYVVMEYVKVRRGWGVWEGGGRVCAYGGGYCHRNM
VVHRDLKPENLLLDAKMNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPE
VDVWSCGVILYALLCGSLPFDDENIPNLFKKIKGGIYNLPSHLSPGARDLIPRMLLVDPL
KRITIPEIRQHPWFNMHLPRYLAVMQAEPVVGVPRIDEEILEEVVRLGFDRDGLLDSLRS
RAANKATVTYYLMTDNR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ggatacaaccagagtgcggagttcttcctcagcaattaccggctagggaaaacactcggc
attggttcctttggcaaggtcaaggtcgcggagcatgtgctcacggggcacaaggtggcg
attaagatcctcaaccggcgtaaaatccagcagatggagatggaggagaaagtccgtcgt
gagatcaagatcctgcggctgttcatgcacccgcacatcatccggctgtatgaggtgatc
gagacgccgtctgatatctacgtggtcatggagtacgtcaaggtgaggaggggatggggg
gtttgggagggaggagggcgtgtgtgtgcatatgggggggggtactgccaccgcaacatg
gtggtccaccgcgacctcaagcccgagaacctgctgctggacgccaagatgaacgtcaag
atcgcggactttggcctgtccaacatcatgcgcgacggccacttcctcaaaaccagctgc
ggctcgcccaactacgccgcgcccgaggtgattagcggcaagctgtatgcgggcccggag
gtggacgtgtggagctgcggcgtcattctgtacgcgctgttgtgtggatcactgcccttt
gacgacgagaacatccccaacctgttcaagaagatcaagggcggcatctacaacctgccc
tcacacctcagcccgggcgcgcgcgacctgatcccgcgcatgctgctggtggacccgctc
aagcgcatcaccatccccgagatccggcagcacccctggttcaacatgcacctgccgcga
tacctggccgtcatgcaggccgagccggtggtgggcgtgccgcgcattgatgaggagatc
ctggaggaggtggtgcggctgggctttgaccgggacgggcttctggactcgctgcgcagc
cgcgccgccaacaaggccaccgtcacctactacctcatgactgacaacagg

DBGET integrated database retrieval system