KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_107651Help
Entry
CHLREDRAFT_107651 CDS       T01039                                 

Definition
TOR binding partner raptor
Orthology
K07204  
regulatory associated protein of mTOR
Organism
cre  Chlamydomonas reinhardtii
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 289 aa AA seqDB search
LVSKWRQKDKVKTTSVALVLCLNIGVDPPDVIKISPCARLECWVDPMSAQPAKALEHIGK
NLQAQYERWQPKAKYKMHLDPTVDDVKKLCASARRYAKNDRVLFHYNGHGVPRPTANGEI
WVFNSRYTQYIPLSVYELQSWVETPCIYVLDCSAAGLILNALRQLVDQRAGGPGGHDASR
GLVRHSASSSLIIVLGACGAGETLPQNPDLPADVFTACLTTPIKVALRWFCSRSLMRHDG
LTKDLIDRIPGKQTDRKSPLGELNWVFTAITDTIAWNVLPRPMFQKLFR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ctggtctccaagtggcggcagaaggacaaagtcaagacgaccagcgttgcgctcgtgctg
tgcctcaatatcggcgttgacccgcctgacgttatcaagatatcgccgtgcgcgcggctg
gagtgctgggttgacccgatgtccgcccagccggcgaaagcgctggagcacataggcaag
aacctgcaggcccagtacgagcgctggcagcccaaggccaagtacaagatgcacctggac
cccaccgtggacgacgtcaagaagctgtgcgccagcgcgcgccgctacgccaagaacgac
cgggtgttgttccactacaacggccacggcgtgccgcggccaaccgccaacggcgagatc
tgggtgttcaactcccggtacacgcagtacatccccctgtccgtgtacgagctgcagtcg
tgggttgagacgccctgcatctacgtgctggactgctcggcagcgggcctcatcctcaac
gcactgaggcagctcgtggaccagcgcgcgggcgggccgggggggcacgacgcctcgcga
ggcctggtgaggcatagcgcgtcgtcctctcttatcattgtgctgggcgcctgtggcgcg
ggcgagacgctgccgcagaaccccgacctgcccgcggacgtgttcacggcctgcctcacc
acccccataaaggtggcgctgcgctggttctgcagccgcagcctgatgcgccacgacggc
ctgaccaaggacctgatcgaccgcatccccggcaagcagaccgaccgcaagtcgccgctg
ggcgagctcaactgggtgttcacggccatcaccgacaccatcgcctggaacgtgctgccg
cggcccatgttccagaagcttttccgc

DBGET integrated database retrieval system