KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_107697Help
Entry
CHLREDRAFT_107697 CDS       T01039                                 

Gene name
HTB42
Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
cre  Chlamydomonas reinhardtii
Brite
Chromosome and associated proteins [BR:cre03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CHLREDRAFT_107697 (HTB42)
Exosome [BR:cre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CHLREDRAFT_107697 (HTB42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa 4HB_MCP_1 DUF3915 NPR3
Motif
Other DBs
NCBI-GeneID: 5726927
NCBI-ProteinID: XP_001701414
JGI: 107697
UniProt: P54347 A8HV98
Position
Unknown
AA seq 153 aa AA seqDB search
MAPKKDEKPATAEAGAEAPAKAEAKPKAEKAAKKAKKEPSKKAAKEPKGDGEKKDKKKKK
SAVETYKLYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEKVATEASKLSRYNKKPTVTS
REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcccccaagaaggacgagaagcccgcgaccgccgaggctggcgccgaggcccctgcc
aaggctgaggccaagcccaaggccgagaaggccgccaagaaggccaagaaggagccctcc
aagaaggctgccaaggagcccaagggcgacggcgagaagaaggacaagaagaagaagaag
agcgccgtggagacctacaagctgtacatctacaaggtgctcaaacaggtgcaccccgac
accggcatcagcagcaaggccatgtccatcatgaacagcttcatcaacgacatctttgag
aaggtggccaccgaggcctccaagctaagccgctacaacaagaagcccaccgtgacctcc
cgcgagattcagaccgccgtgcgcctggtgcttcccggcgagctggccaagcacgcggtg
tcggagggcaccaaggccgtgaccaagttcacctcgggctaa

DBGET integrated database retrieval system