KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_107955Help
Entry
CHLREDRAFT_107955 CDS       T01039                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CHLREDRAFT_107955
Transfer RNA biogenesis [BR:cre03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CHLREDRAFT_107955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 322 aa AA seqDB search
GMGADEARVRAIAEVVSLLVAGVREGRDVDLNQLKCEVSRRYKLARSPKLVEIIAALPEE
HRTTLLPMLRAKPVRTASGIAVVAVMSKPHRCPHIATTGNICIYCPGGPDSDFEYSTQSY
TGYEPTSMRAIRARYDPYVQARGRVDQLRKLGHVVDKVEYILMGGTFMSLPSDYRDFFIR
NLHDALSGHASSCVREVRAGGREGGERGGCRERVLKPMAAPGQLRAASSPASCPTNPSAH
HARSGHTVAAVKQCFVQAKDAGFKVVVHMMPDLPAVGWERDIECFREFFENPHFRTDGLK
LYPTLVIRGTGLYELWKRGLYR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ggcatgggcgcggacgaggcccgggtgcgcgccatcgccgaggtggtgtcgctgctggtg
gcgggggtgcgggaggggcgagacgtggacctcaaccagctcaagtgcgaggtcagccgg
cgctacaagctggcgcgctcgcccaagctagtggagatcatagcggcgcttcccgaggag
caccgcaccacgctgctgcccatgctgcgagccaagcccgtacgcaccgcttcgggcatt
gcggtggtggcggtcatgtccaagccgcaccgctgcccgcacatcgccaccaccggcaac
atctgcatctactgccccgggggccccgactcggactttgagtacagcactcagtcgtac
acggggtacgagcccaccagcatgagggccatacgggcgcggtacgacccgtacgtgcag
gcgcgcggtcgggtggaccagctgcgcaagctgggtcacgtggtggacaaggtggagtac
atcctcatgggcggcaccttcatgtcgctgccatctgactaccgcgacttcttcattcgc
aacctgcacgacgcgctcagcggccacgccagcagctgcgtgcgcgaggtgagggcgggc
gggcgggagggcggcgagagaggaggatgtcgggagcgtgtgctcaagcctatggcagcg
cccggccaactgcgcgccgcctcatcgcccgcctcgtgccccaccaacccatccgcacac
catgctcgcagcggccacacggtggcggcggtcaagcagtgtttcgtgcaggccaaggac
gccggattcaaggtggtggtgcacatgatgccggacctgccggcagtgggctgggagcgc
gacatcgagtgcttccgcgagttcttcgagaacccgcacttccgcaccgacggcctcaag
ctctaccccacactggtcatccgcggcacggggctgtacgagctgtggaagcgggggctg
tacagg

DBGET integrated database retrieval system