KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_108251Help
Entry
CHLREDRAFT_108251 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:cre04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 347 aa AA seqDB search
GLAGLSNLGNTCFMNSSLQCLAHAVPLMQAFLGGTYIKDLNRTNPLGMKGELAEAFGMLL
QQLWRGGVSSVSPRSFKAKIGRFAPQFSGYAQHDSQEFLAFLLDGLHEDTNRIKTKPYFE
TKDEPGRPDEELATEAWSQYRARNNSLVVDHFQGLLKSGLDCPKCAYHSVKFDPFMYLSL
PLPESRRRPVALEDCMRVFLQPERLDESDAWYCPRCKEHVCADKKLDLWSLPEVLVVHLK
RFSYTRYSRNKLDTRVDFPLHGLDLGSYVLRAQGVAPLYDCFAVSNHFGSMGGGHYTAYA
KLPGPPPGTAAGADGAEAWYCFDDSHVSAVEPEAVRSSAAYVLFYRR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
ggcctggctggtctgtccaacctgggcaacacctgcttcatgaactccagcctgcagtgc
ctggcgcacgccgtgccgctcatgcaggccttcctgggcggaacatacatcaaggacctg
aaccgcaccaacccgctgggcatgaagggggagctggcagaggcgtttggcatgctcctg
cagcaattgtggagggggggcgtgtcctcggtgtcgccacgcagcttcaaggccaagatc
ggccgcttcgcgccacagttcagcggctacgcacagcacgactcgcaggagttcctggcg
ttcctgctggacgggctgcacgaggacaccaaccgcatcaagaccaagccctacttcgag
accaaggacgagccgggccggcccgacgaggagctggccactgaggcgtggtcccagtac
cgggcacgcaacaacagcctggtggtggaccacttccagggcctgctcaagagcgggctg
gactgccccaagtgcgcctaccactcggtgaagttcgaccccttcatgtacttgtcgctg
ccgctgcccgagagccggcggcggccggttgcgctggaggactgcatgcgcgtgttcctg
cagccggagcggctagacgagagcgacgcctggtactgcccccgctgcaaggagcacgtg
tgcgcggataaaaaactagacttgtggagcctgccggaggtgctggtggtgcacctgaag
cgcttcagctacacgcgctactcgcgcaacaagctggacacgcgtgtggacttcccgctg
catggcctggacctgggcagctacgtgctgcgggcgcagggcgtggcgccgctgtacgac
tgcttcgccgtgtccaaccacttcggatccatgggcggggggcattacaccgcctacgcc
aagctgccagggccgccgccaggcacggcggcgggtgcggacggcgcggaggcgtggtat
tgcttcgatgactcgcacgtgtctgcggtggagcccgaggccgtgcgctcatccgccgcc
tatgtgctcttctaccgccgc

DBGET integrated database retrieval system