KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_108913Help
Entry
CHLREDRAFT_108913 CDS       T01039                                 

Definition
histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CHLREDRAFT_108913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 273 aa AA seqDB search
MPQPPARLQVSYYYDPDIGDFYYGQGHPMKPHRVRLAHCLVTRYDLWHHLDIVRPCPARK
SDLVAFHTPDYVDFLRAVTPANQRSLQRETAAGTVTAIGNVKGSATETGQIRLGGKTAAR
SGSATNRRPVMRKRAASHSRSSRHYRRHRRTARWLCDTDPCVQGHCAWPILPHFLRWFDC
TSTRGGGVEEAFLTSDRVMTVSFHKHGDNFFPGTGDTADCGVGAGRGYAVNVPLRDGMDD
PAYEGLFRPVMGAVMERFRPEAIVLQSGAGGGV
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaaccccccgcccgcctgcaggtgtcgtactactacgaccccgacatcggcgac
ttctactacgggcagggccaccccatgaagccgcaccgtgtgcgcctggcgcactgcctg
gtcacccgctacgacctgtggcaccacctggacattgtgcggccctgccccgcccgcaag
tcggacctggtggccttccacacgcccgactacgtggacttcctgcgggccgtcacaccc
gcaaaccagcgaagcctgcagcgcgagaccgcagccgggacggtgaccgcgatcgggaac
gtcaagggaagcgcgaccgagaccggacagattcggctcggcggcaagacagcagcaagg
agcgggagcgcgacaaacaggcgtcccgtgatgcggaaacgggccgccagccacagtcgc
agcagcaggcactaccgccgccaccgccggactgcgcgatggctgtgcgacactgacccc
tgtgttcaaggccactgcgcctggccgatcctgccacacttcctcaggtggttcgactgt
acttccactcgcgggggcggggtggaggaggccttcctcaccagcgaccgggtgatgact
gtgtcgttccacaagcacggcgacaacttcttccccggcaccggcgacacggccgactgc
ggggtgggcgcgggccgcgggtacgcggtgaacgtgcctctgcgtgacggcatggacgac
cccgcctacgaggggctgttccggccggtcatgggggccgtcatggagcgattcagaccc
gaggccatcgtgctgcagagcggtgcgggagggggtgtgtga

DBGET integrated database retrieval system