KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_109462Help
Entry
CHLREDRAFT_109462 CDS       T01039                                 

Gene name
HTB26
Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
cre  Chlamydomonas reinhardtii
Brite
Chromosome and associated proteins [BR:cre03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CHLREDRAFT_109462 (HTB26)
Exosome [BR:cre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CHLREDRAFT_109462 (HTB26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like 4HB_MCP_1
Motif
Other DBs
NCBI-GeneID: 5724511
NCBI-ProteinID: XP_001698956
JGI: 109462
UniProt: A8JJG8
Position
Unknown
AA seq 73 aa AA seqDB search
SAVETYKLYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEKVATEASKLSRYNKKPTVTS
REIQTAVRLVLPG
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
agcgccgtggagacctacaagctgtacatctacaaggtgctcaagcaggtgcaccccgac
accggcatcagcagcaaggccatgtccatcatgaacagcttcatcaacgacatctttgag
aaggtggccaccgaggcctccaagctgagccgctacaacaagaagcccaccgtgacctcc
cgcgagatccaaaccgccgtgcgcctggtgctgcccggc

DBGET integrated database retrieval system