KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_113408Help
Entry
CHLREDRAFT_113408 CDS       T01039                                 

Definition
NADH-dependent histone deacetylase
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     CHLREDRAFT_113408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 269 aa AA seqDB search
MSLGYADRLKPKKNLGGQLGAQEFHQDLDDIKKGVKELAGWVRDAKRVFVFTGAGISTAC
GIPDFRGPNGIWTLRKKGEALPTDFTPFEYARPSFTHMAISGLVAAGKCPYVCSQNVDSL
HLWSGVPRSRIAELHGNCFAERCRGCGAEYARDFQMETVDFRPSGRRCTAPGCGGELVDN
ILDWDTPLPQDELDEAVRQAEEADVALVLGTSLQIQPANEIPVLTRDEGGKLVIVNLQKT
PKDRRANLLLRARVDLAMALLARELGMQV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgggatacgctgaccgtttaaagccgaagaaaaaccttggcgggcagctcggc
gcgcaagagttccaccaggacctcgacgacatcaaaaagggcgtcaaggagctagcggga
tgggtccgcgacgccaagcgcgtgtttgtgttcacgggcgccggcatctccaccgcctgc
ggcatccctgactttcgcggccccaacggcatctggacgctgcgcaagaagggtgaggcg
ctgcccaccgacttcacgccctttgagtacgcgcggcccagcttcacacacatggccatc
tcgggcctggtggccgcgggcaaatgcccctacgtgtgcagccagaacgtggacagcctg
cacctgtggagcggcgtgccgcggtcgaggatcgcggagctgcacggcaactgcttcgca
gagcggtgccgggggtgcggcgccgagtacgcgcgcgacttccagatggagacggtggac
ttccggcccagcggccggcgctgcacggcgcccggctgcggcggcgagctggtggacaac
atcctggactgggacacacccctgccgcaggacgagctagacgaggcggtgcggcaggcg
gaggaggcggacgtggcgctggtgttgggcacctcgctgcagatccagccggccaacgag
atccccgtgctcacacgtgacgagggcggcaagctggtgattgtgaacctgcagaagacg
cccaaggaccggcgagccaacctgctgctgcgcgcccgcgtggacctggccatggcgctg
ctggcgcgggagctgggcatgcaggtg

DBGET integrated database retrieval system