KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_114243Help
Entry
CHLREDRAFT_114243 CDS       T01039                                 

Gene name
PIMT2
Definition
protein-l-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cre  Chlamydomonas reinhardtii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 220 aa AA seqDB search
ANDSNQKLVDSLKAQGLLKSERCEAVMRQIDRRDFTTTHLGIPAHDSQLPIGQGQSISAP
SLHATCLELLESHARPGALALDVGSGSGYFTACLSLMVGAEGRVVAVERYQRLLEQSGVA
TRVGTAEPSLTGGHAPLRPELQAGRPLFDLVHVGAAVRQPPPELLALLRPGGRMVVAVGP
PAAMQSLAVVDKGQDGAITRTAVCDVRLPPLAQPFADRPL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gccaacgacagcaaccagaagcttgtggactcgctaaaagcgcaggggctgctcaaatca
gagcgctgcgaggcggtgatgcggcaaatcgaccggcgggacttcaccacgacacacctg
ggcatccccgcgcatgacagccagttgcccatcgggcagggccagagcatctcggcgcct
tcgctgcacgcgacgtgtctggagctgttggaatcgcacgcacggccgggggcactggcg
ctagacgttggctcgggctccggctacttcaccgcctgcctgtcgctgatggttggggct
gaggggcgcgtggtcgcggtggagcgctaccagaggctgctggagcagtcaggtgtggcc
acccgggtgggtaccgcggagcccagcctcaccggcggccatgcaccgctgcggccggag
ctgcaggcgggccggccgctgttcgacctggtgcacgtgggcgcggcggtgcgtcagccg
ccgccggagctgctggcgctgctgcggccgggcgggcgcatggtggtggcggtggggccg
ccggcggccatgcagagcctcgcagtggtggacaaggggcaggacggggccatcacgcgg
acagctgtctgcgacgtgcggttgccgccgctggcgcaaccgtttgcagacaggcccctg
taa

DBGET integrated database retrieval system