KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_116375Help
Entry
CHLREDRAFT_116375 CDS       T01039                                 

Gene name
NCR2
Definition
NADPH-cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     CHLREDRAFT_116375 (NCR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 602 aa AA seqDB search
EDPSKPCVRILYGTQTGTAERFSKQLANELRGKYGDSTAVDVRDVETYKPERLGSEKLVV
MCMATYGDGEPTDNAAVFYSWLLKEAEAEPFLQGVSYAVFGLGNKQYEHFNSVGKKVFKA
MKACGATALCRRGDGDDDGVIDDDFEKWCTELYEALDKSSDLVGKRADQNGVHAAPPARV
AAYEVEVLRGSGGEAPAFPSGTGKDVHSPFWAKITTVRELHTPASDRSCVHVEVDVSGSG
ITYEAGDHIAIYARNGEAVVSQVAELLGFDLEARIKLALPADADAASGLPPPFPGPVTVR
TALSYFADVLSSPHREALNALASFAADREEAARLALLGSPAGKAEYADFIGKPHRSLLEV
LQAFPSAKPTIGAFFGCIAPRLQPRFYSISSSPKQHPNSVHVTCAVVRDTMPTGRVHEGV
ASTWLQRHGNGAAVPVFVRHSHFRLPKAASTPVVMVGPGTGLAPFRGFLQERAALKNSGA
ELGPAHLFFGCRSRGTDYIYQQELEGYVADGVLSNLHVAFSRDQSSKDYVQHHIGREAAA
LWPIIGEQGAHLYVCGDAKYMAKDVHKAFVALVEKGKGCSGTQAEMFVKELTDAGRYQRD
VW
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
gaggaccccagcaagccttgcgtgcgcatcctctacggcacccagacgggcacggcggag
cgcttctccaagcagcttgccaacgagctgcgcggcaagtatggggacagcacggccgtg
gatgtgcgcgacgtggagacctataaaccagagcggctgggcagcgagaagctggtggtg
atgtgtatggcgacgtatggcgatggcgaacccaccgataacgcagcggtcttctactcg
tggctgctcaaggaagcggaggcagagccgtttctgcagggtgtctcttatgccgtgttt
gggctgggcaacaagcagtacgagcacttcaactcggtgggcaagaaggtgttcaaggcc
atgaaggcgtgcggcgccaccgcgctgtgccgccgcggcgacggcgacgatgacggcgtc
atcgacgacgacttcgagaagtggtgcactgagctgtacgaggcgctggacaagtccagc
gatctggtcggcaagcgtgccgaccagaacggcgtgcacgcggcgccaccggcgcgtgta
gccgcgtacgaagtggaggtgctgcgcgggagcggcggcgaggcgccagcctttccctcg
ggcaccggcaaggacgtgcacagccccttctgggccaagattaccaccgtgcgcgagctg
cacacccccgcatcggaccgcagctgcgtgcacgtggaggtggatgtcagcggctcgggc
atcacctacgaggcgggcgaccacatcgccatctacgcccgcaacggcgaggcggtggtg
agccaggtggccgagctgctgggctttgacctagaggcccgcattaagctggcgctgccg
gcggacgcagatgccgcctcaggcctgccgccgcccttccccggccccgtcaccgtgcgc
accgcgctgtcctacttcgcggacgtgctgtccagcccgcaccgtgaggcgctgaacgcg
ctggccagcttcgcggcggaccgggaggaggcggcgcgccttgcgctgctgggctcgccg
gctgggaaggccgagtacgcggacttcatcggcaagccgcaccgcagcctgctggaggtg
ctgcaggccttccccagcgccaagcccaccatcggcgccttctttggctgtatcgcgcca
cgcctgcagcctcgcttctactcaatctcctcctcgcccaagcagcacccaaacagcgtg
cacgtcacgtgcgccgtggtgcgcgacaccatgcccaccggccgcgtgcacgagggcgtg
gcgtcgacgtggctgcaacgccacggcaacggcgcggcggtgcccgtgtttgttcggcac
tcgcatttccgcctgcccaaggcggccagcacgccggtggtaatggtgggccccggcacc
ggcctagcgcccttccgcggcttcctgcaggagcgcgccgcgctcaagaactcgggtgcg
gagctgggccctgcgcacctgttctttggctgccgctcgcgcggcactgactacatctac
cagcaggagctggaggggtatgtggcggacggagtgctgtcgaacctgcacgtggccttc
tcgcgcgatcagtcctccaaggactacgtgcagcaccacatagggcgggaagcggccgcg
ctgtggccgatcatcggggagcagggtgcccacctgtacgtgtgtggagacgccaagtac
atggcgaaggacgtgcacaaggccttcgtggcgctggtggagaagggcaagggctgcagc
ggcacgcaggcggagatgttcgtgaaggagctcacagacgccgggagataccagcgcgat
gtctggtaa

DBGET integrated database retrieval system