KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_116873Help
Entry
CHLREDRAFT_116873 CDS       T01039                                 

Gene name
AGA1
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CHLREDRAFT_116873 (AGA1)
  Lipid metabolism
   00561 Glycerolipid metabolism
    CHLREDRAFT_116873 (AGA1)
   00600 Sphingolipid metabolism
    CHLREDRAFT_116873 (AGA1)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    CHLREDRAFT_116873 (AGA1)
Enzymes [BR:cre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CHLREDRAFT_116873 (AGA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 328 aa AA seqDB search
LKNGVGKTPAMGWNSWNYFRCNINETIIRSVADAIVSSGLMDAGYVYVNIDDCWMEKRDN
ATGRIVPFADKFPSGMKALGDYIHSLGLKFGVYSDTGKHTCEGYPGSAGYEEQDAATYAE
WGVDYLKFDYCDMQDTKESATYERMRDALAATGRPILFSLCSWGSGQPWLWGKDVGNSWR
TGIDVFAAWDAAQAKALKLPNFLQPILGAGLAPYAGPGGFNDPDMLVVGGLTQTEQRTHF
AFWCIMAAPLILGNDPRAMSKATLEILLAREVLAVNQDPLGLQGRPVWTQELDGASAGKS
LEIWTKPLADGRTAMLLVNLGEATVDIT
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
ctgaagaatggggttggcaaaacccctgcaatgggctggaactcgtggaactactttcgg
tgcaacataaacgagaccatcattcggtccgttgctgacgccatcgtgtcatcgggcctg
atggacgcgggctacgtatacgtcaacatagatgactgctggatggagaagcgcgacaac
gccacgggccgcattgtaccgttcgcggacaagttcccttccggcatgaaggctctgggt
gactacatccacagcctgggcctcaagttcggcgtgtactcggacacgggcaagcacacg
tgcgaggggtacccgggcagcgccggttacgaggagcaggacgcggccacgtatgcggag
tggggcgtggactacctcaagtttgactactgcgacatgcaggacaccaaggagagcgcc
acgtatgagcgcatgcgcgacgctctggccgccaccggccgccccatcctgttcagcctg
tgctcgtggggctcggggcagccctggctgtggggcaaagacgtgggcaactcctggcgc
accggcatcgacgtgttcgcggcctgggacgcggcccaggccaaggcgctcaagctgccc
aacttcctgcagcccatcctgggcgcaggtctggctccgtacgcgggcccgggcggcttc
aacgaccccgacatgctggtggtgggcgggctgacgcagacggagcagcgcacgcacttc
gccttctggtgcatcatggcggcgccgctcatcctgggcaacgacccgcgggccatgagc
aaggccacgctggagatcctgctggcgcgcgaggtgctagcggtgaaccaggacccgctg
ggtctgcagggccggccggtgtggacgcaggagctggacggcgccagtgcgggcaagagc
ctggagatctggaccaagccgctggcggacgggcgcactgccatgctgctggtcaacctg
ggcgaggccactgtcgacatcacc

DBGET integrated database retrieval system