KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_117456Help
Entry
CHLREDRAFT_117456 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CHLREDRAFT_117456
Peptidases [BR:cre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CHLREDRAFT_117456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 263 aa AA seqDB search
KQGAGLHNLGNTCFMNSVLQSLHPPPTAASPAALPILSPSCEDSHEFLRCLLDAMHEACL
RRFRPAKPPPELAATTFVYRIFGGRLKSQIECDGVDYVSRTFDPFLDLSLEINRAASLER
ALAAFTAAEVLTAPTTSHGRRCGSCASWVRATKRISIEDAPNVLTVHLKRFEYGGFGAKI
NKHVAFGTELNLRPYMSATKGPALMYDLYGVLVHHGYSVNSGHYICYVKAANGLWHVCDD
HRVAAVGERTVLDQRAYILFYIR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
aaacagggcgctggccttcacaacctcggaaacacgtgcttcatgaacagcgttctgcag
tccctccacccgccacccaccgctgcatcccccgccgccctccctattctgtctccctct
tgtgaggactcccacgagttcctgcgctgcctgctggacgccatgcatgaggcctgcctg
cgccgcttccggccggccaagccgccgccggagctggccgcaaccacctttgtgtaccgc
atctttggcggccgactcaagagccagatcgagtgcgacggcgttgactacgtcagccgt
acctttgaccccttcctggacctcagcttggagatcaaccgcgcggcttcgctggagcgc
gcgctggcggccttcacggcagccgaggtgctgacggcgccaacaacaagccacgggcgg
cggtgcggctcatgtgccagctgggtccgcgccaccaagcgtatcagcattgaggacgcg
cccaacgtgctgaccgtgcacctgaagcgcttcgagtacggcggctttggcgccaagatc
aacaagcacgtggccttcggcaccgagctcaacctgcggccctacatgagcgccaccaag
ggaccggcgctgatgtacgacctgtacggcgtgctggtgcaccacggctacagcgtcaac
agcggccactacatctgctacgtcaaggcggccaacgggctgtggcacgtgtgcgacgac
caccgcgtagccgccgtcggcgagcggacggtgctcgaccagcgcgcttacatcctcttc
tacatccgg

DBGET integrated database retrieval system