KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_117574Help
Entry
CHLREDRAFT_117574 CDS       T01039                                 

Definition
(RefSeq) predicted protein
Organism
cre  Chlamydomonas reinhardtii
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh DUF1295 PEMT
Motif
Other DBs
NCBI-GeneID: 5718276
NCBI-ProteinID: XP_001692692
JGI: 117574
UniProt: A8IV16
Position
Unknown
AA seq 178 aa AA seqDB search
NLVMLCGWLLHYLYRGFITPFIMPYSSRTVALGIPLAGIVPNCIFGYLVATQLACTRYPS
DWAGRPRYIIGVVLYALGTAINRWADLKLRAGRSSPASLSRYFIPQGGLYDYIACPNYLG
ELIEWAGFAVGTWSWPALSWLLFCTSTFVPRALTHLRWYRDTFPEYPRSRKALIPFVL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
aacctggtgatgttgtgcggatggctgctgcactacctctaccgcggcttcatcacgccc
ttcatcatgccctacagcagtcgaacggtggcgctgggcatcccgctcgcaggcatcgtg
cccaactgcatattcggatacctcgtcgccacgcagctggcgtgcacccggtacccgtcg
gactgggccggccgcccccgctacatcatcggagttgtgctgtacgccctcggtacggca
atcaatcgctgggctgatctgaaactgcgggcggggcgctcgtcgccggctagcttgagc
cggtacttcataccgcaggggggcttgtacgattacatcgcctgccccaactacctcggc
gagctgattgagtgggcgggcttcgccgtgggcacttggtcatggccggcgttgtcgtgg
ctgctgttctgcacatccaccttcgtgccgcgggccctgacacacctgcgctggtaccgc
gacaccttccccgagtacccgcgctccaggaaagccctcatccccttcgtactgtag

DBGET integrated database retrieval system