KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_117883Help
Entry
CHLREDRAFT_117883 CDS       T01039                                 

Gene name
FAD5A
Definition
MGDG specific palmitate delta-7 desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CHLREDRAFT_117883 (FAD5A)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CHLREDRAFT_117883 (FAD5A)
Enzymes [BR:cre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CHLREDRAFT_117883 (FAD5A)
Lipid biosynthesis proteins [BR:cre01004]
 Desaturase
  First
   CHLREDRAFT_117883 (FAD5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 306 aa AA seqDB search
MEEPGVGRVFLSDVATKGKRPSFLNRDWNSTDKAFLAFIGGMHLLACCAPFTYSPQMVAL
FLASYFVTGCLGITLSYHRMLSHKSFTVPKWLEYILAYCGVLAVQGDPLEWSSSHRYHHL
HTDTPLDPHSPYEGFWWCHMGWLLDNNATMERVSNRSNADDLESQWYYRWLRDTYPFHVA
AQLAVLFLVGGFPAVVWGGALRMCWVWHITWFVNSASHCWGYQDYNTGDLSKNNWWVGIL
AFGEGWHNNHHAFEFSARHGFEWWQVDMTWYIILALQKVGLATNVKLPTERQKAKLAFKK
PAEAAA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcctggtgtcggccgcgtgttcttgtcggatgtggccacaaagggcaagcgg
ccctcgttcctcaaccgcgactggaactccacggacaaggcgttcctggccttcatcggc
ggcatgcacctgctggcctgctgcgcgcccttcacctactcgcctcagatggtggcgctc
ttcctggcctcctacttcgtgaccggctgcctaggcatcacgctctcctaccaccgcatg
ctcagccacaagtccttcaccgtgcccaagtggctggagtacatcctggcgtactgcggc
gtgctggccgtgcagggcgaccccctggagtggagcagcagccaccgctaccaccacctg
cacaccgacaccccgctggacccccactcaccctacgagggcttctggtggtgccacatg
ggctggctgctggacaacaatgccaccatggagcgggtgtcgaaccgctccaacgcggac
gacctggagagccagtggtactaccgctggctgcgcgacacctaccccttccatgtggct
gctcagctggccgtgctgttcctggtcggtggcttccccgccgtcgtctggggtggcgcg
ctgcgcatgtgctgggtgtggcacatcacgtggttcgtgaactcggcctcgcactgctgg
ggctaccaggactacaacaccggcgacctgtcgaagaacaactggtgggtgggcatcctg
gcctttggcgagggctggcacaacaaccaccacgccttcgagttctctgcgcgccacggc
ttcgagtggtggcaggtggacatgacctggtacatcatcctggctctccagaaggtgggc
ctggccaccaacgtgaagctgcccacggagcgccagaaggccaagctggccttcaagaag
cccgccgaggcggctgcataa

DBGET integrated database retrieval system