KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_117883Help
Entry
CHLREDRAFT_117883 CDS       T01039                                 

Gene name
FAD5A
Definition
MGDG specific palmitate delta-7 desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cre01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cre01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 306 aa AA seqDB search
MEEPGVGRVFLSDVATKGKRPSFLNRDWNSTDKAFLAFIGGMHLLACCAPFTYSPQMVAL
FLASYFVTGCLGITLSYHRMLSHKSFTVPKWLEYILAYCGVLAVQGDPLEWSSSHRYHHL
HTDTPLDPHSPYEGFWWCHMGWLLDNNATMERVSNRSNADDLESQWYYRWLRDTYPFHVA
AQLAVLFLVGGFPAVVWGGALRMCWVWHITWFVNSASHCWGYQDYNTGDLSKNNWWVGIL
AFGEGWHNNHHAFEFSARHGFEWWQVDMTWYIILALQKVGLATNVKLPTERQKAKLAFKK
PAEAAA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcctggtgtcggccgcgtgttcttgtcggatgtggccacaaagggcaagcgg
ccctcgttcctcaaccgcgactggaactccacggacaaggcgttcctggccttcatcggc
ggcatgcacctgctggcctgctgcgcgcccttcacctactcgcctcagatggtggcgctc
ttcctggcctcctacttcgtgaccggctgcctaggcatcacgctctcctaccaccgcatg
ctcagccacaagtccttcaccgtgcccaagtggctggagtacatcctggcgtactgcggc
gtgctggccgtgcagggcgaccccctggagtggagcagcagccaccgctaccaccacctg
cacaccgacaccccgctggacccccactcaccctacgagggcttctggtggtgccacatg
ggctggctgctggacaacaatgccaccatggagcgggtgtcgaaccgctccaacgcggac
gacctggagagccagtggtactaccgctggctgcgcgacacctaccccttccatgtggct
gctcagctggccgtgctgttcctggtcggtggcttccccgccgtcgtctggggtggcgcg
ctgcgcatgtgctgggtgtggcacatcacgtggttcgtgaactcggcctcgcactgctgg
ggctaccaggactacaacaccggcgacctgtcgaagaacaactggtgggtgggcatcctg
gcctttggcgagggctggcacaacaaccaccacgccttcgagttctctgcgcgccacggc
ttcgagtggtggcaggtggacatgacctggtacatcatcctggctctccagaaggtgggc
ctggccaccaacgtgaagctgcccacggagcgccagaaggccaagctggccttcaagaag
cccgccgaggcggctgcataa

DBGET integrated database retrieval system