KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_118171Help
Entry
CHLREDRAFT_118171 CDS       T01039                                 

Gene name
AMYA1
Definition
alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CHLREDRAFT_118171 (AMYA1)
Enzymes [BR:cre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CHLREDRAFT_118171 (AMYA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 408 aa AA seqDB search
MPPALTGFAWDSCFKNAWYNTVASKVDAIKAVGVTHVWLPPPSQSVAPQGYLPGQLYNLN
SKYGTKEQLVRLTQALRAAGIKPIADIVINHRSCRREGLMVRHRWAGMAPGRRLDWGRWA
ITCNDPEFKGQGNPDTGDDYGAAPDLDHANPELRAALVDWLGWLQRDIGFEGWRLDFARG
YGAQFVTQYVDATVGADSLNVGEYWVDLVWAGSDLEYNQDAARQRLCDWCVRAGNGERCC
AFDFPTKGLLQEAVKRAQYDRLRDRQGKAPGLVGWWPGKAVTFIENHDTGSTQQHWPFPS
SHVSLGYAYILTHPGVPCVFWDHLFDWGEDVRKAITGLVALRRRAGLHSESKLEILAAEP
DMYVARVGEKVTVKLGPRYDMGNLLPKEAEGWKFVMSGKDWAVWEKTN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctgcgctgacaggctttgcctgggacagctgcttcaaaaacgcctggtacaac
accgtggccagcaaggtagacgccatcaaggcggtgggagtgacgcacgtttggttgccg
ccgccgtcccagagcgtggcgccgcagggctacctgcccggccagctgtacaacctgaac
tccaagtacggcaccaaggagcagctggtgcggctgacacaggcgcttagggcggcgggc
atcaagcccatcgccgacatcgttatcaaccaccgttcttgcaggcgcgaggggttgatg
gtgaggcaccggtgggcaggcatggccccaggtcggcggctggactggggccgctgggcc
atcacctgcaatgacccggagttcaaggggcagggcaaccccgacacgggtgacgactac
ggtgccgcgcccgacctcgaccacgccaaccccgagctgcgggctgcgctggtggactgg
ttgggctggctgcagcgcgacatcggcttcgagggctggaggctggactttgcgcgcggc
tacggcgcccagttcgtgacgcagtacgtggacgccacggtgggcgccgacagcctcaac
gtgggcgagtactgggtggacctggtgtgggccggcagcgacctcgagtacaaccaggac
gcggcgaggcagaggctgtgcgactggtgcgtgcgggcgggcaacggcgagcgctgctgc
gcctttgacttccccaccaaggggctgctgcaggaggcggtcaagcgggcgcagtacgac
cgactgagggaccggcagggcaaggcgccggggctggtgggctggtggccgggtaaggcg
gtaactttcattgagaaccacgacacgggcagcacgcagcagcactggcccttcccctcc
agccacgtcagcctgggctacgcctacatcctcacacacccgggcgtgccctgtgtgttt
tgggaccacctgtttgactggggcgaggacgtgcgcaaggccatcaccggcctggtggcg
ctgaggcggcgcgccggcctgcactccgagagcaagctggagatcctggcggcggagccc
gacatgtacgtggcgcgcgtcggagagaaggtgactgtgaagctgggtccgcgctatgac
atgggcaacctgctacccaaggaggccgagggctggaagttcgtgatgagcggcaaggac
tgggcggtgtgggagaagaccaactga

DBGET integrated database retrieval system