KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_118976Help
Entry
CHLREDRAFT_118976 CDS       T01039                                 

Gene name
SBE1
Definition
starch branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CHLREDRAFT_118976 (SBE1)
Enzymes [BR:cre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CHLREDRAFT_118976 (SBE1)
Exosome [BR:cre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CHLREDRAFT_118976 (SBE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 690 aa AA seqDB search
STSSSAADEGDGLGVIAVDPALANFKGHLEYRWAQYRRTLDSITAGAGSLAAFAEGYKYF
GFNREDGAIVYREWAPAAQAAALIGDFSKWEPVWMTRDEWGVWSVRLEDVDGKPAIPHRS
RVKVRLQHPHGWWMDRVPAWIKWAAAEQRMDAKYDGIYWDPPAAERHQWRHQRPPRPAAL
RIYEAHVGMSSETGKVASYSEFTDTVLPRVQALGYNAIQLMAIQEHAYYGSFGYHVTNPF
AVSSRSGTPEELKALALIDEAHRRGIAVLLDVVHSHISGNQDDGLAGFDMGQREQDNYFK
QGEAGYHKLWDSRCLNYANWECQRYLLSNLRYWLEEYQFDGFRFDGVTSMLYHHHGIHTS
FSGDYNEYLGTSTNVDAVVYLMMANRLVHDLVPSAVTIAEDVSGMPALCRPVAEGGVGFD
ARLNMSIPDTWIKLLKHVRDEHWRMQDIVSALCNRRYTEKSIGYAESHDQALVGDQTIAF
RLMGPEMYSGMSALTEATPVVSRGVALHKLIRLVTMALGGEGWLSFMGNEFGHPEWIDFP
RDGNGWSHHYCRRQWSLADTDHLRYKFLQAWDAAMMALDNHYGFLASPHQWVTHMDEPEQ
ILVFERGPLLFVFNWSPIADREAYRVAVPAPGKWRVALDSDAWDYGGAGRVFHDADHFSD
PEPAGTSRDREHSIRVLAPARTCAVYYNAD
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
agcaccagcagcagcgccgcagatgagggcgacggtctgggtgtgattgcagtggaccca
gcgctggccaacttcaaaggccacctggagtatcgctgggcccagtacaggcgcacgctg
gactccatcaccgcgggcgcgggcagcctggcggcctttgcggagggatacaagtacttt
ggattcaaccgggaggacggcgctattgtgtaccgggagtgggcgccggcggcccaggcg
gcggcgcttatcggcgacttcagcaagtgggagccggtgtggatgacccgcgacgagtgg
ggcgtgtggagtgtgcggctggaggacgtggacggcaagcccgccattccgcaccgctcc
cgtgtcaaggtccggctgcagcacccccacggctggtggatggaccgtgtgcccgcctgg
atcaagtgggcggcggcggagcagcgcatggacgccaagtacgacggcatctactgggac
cccccggcggcggagcggcaccagtggcgccaccagcgcccgccgcggcccgcggccctg
cgcatctatgaggcgcatgtgggcatgagttcggagaccggcaaggtggccagctacagc
gagttcaccgacacggtgctgccacgtgtccaggcgctgggctacaacgccattcagctc
atggccatccaggagcacgcctactacggctccttcggctaccacgtgaccaaccccttc
gcggtcagcagccgcagcggcacacccgaggaactcaaggcactagctctgattgacgag
gcccaccgtcgcggcatcgccgtactcctggacgtggtccacagccacatcagcggcaac
caggacgacggcctggcggggttcgacatggggcagcgcgagcaagacaactacttcaag
cagggcgaggcgggctatcacaagctgtgggacagccgctgcctcaactacgccaactgg
gagtgccagcgctacctgctgtccaacctgaggtactggctggaggagtaccagttcgac
ggattcaggttcgacggcgtgacctccatgctctaccaccaccacggcatccacacctca
ttcagcggcgactacaacgagtatctgggcacctccaccaacgtggacgcagtggtgtac
ctcatgatggcaaacaggctggtgcacgacctggtgcccagcgcggtgaccatcgccgag
gatgtgagcggcatgccggcgctgtgccgccccgtggcggagggcggcgtgggctttgac
gcgcgcctcaacatgtccattcccgacacctggatcaagctgctgaagcacgtgcgggac
gagcactggcgcatgcaggacatcgtgtcggcgctgtgcaaccggcgctacaccgagaag
agcatcgggtacgccgagagtcacgaccaggctctggtgggcgaccagaccattgcgttc
cggctgatgggtccggagatgtacagcggcatgagcgcgctgacggaggccactcccgtg
gtgtcccggggtgtggcgctgcacaagctgatccggctggtcacgatggccctgggcggc
gagggctggctcagcttcatgggcaacgagttcgggcaccccgagtggatcgatttcccg
cgtgacggcaacggctggagccaccactactgccggcggcagtggtcgctcgcggacacc
gaccacctgcgctacaagttcctgcaggcctgggacgcagccatgatggccctcgacaac
cactacggcttcctggcctcgccgcaccagtgggtgacccacatggacgagccggagcag
atcctggtgttcgagcgcggcccactgctgttcgtgttcaactggagccccatcgccgac
cgcgaggcctaccgcgtggcggtaccggcgcccggcaagtggcgggtggcgctggacagc
gacgcctgggactatggcggcgcgggccgggtgttccacgacgcggaccacttcagtgac
cccgagcccgccggcaccagccgcgaccgcgagcactccatccgggttctggcgcccgca
cgcacctgcgcggtgtactacaacgcggac

  All links  
No link information was found.   
DBGET integrated database retrieval system