KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_119565Help
Entry
CHLREDRAFT_119565 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cre  Chlamydomonas reinhardtii
Brite
Protein phosphatases and associated proteins [BR:cre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CHLREDRAFT_119565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 159 aa AA seqDB search
MGGKLTKKDVERLQRRFQRLANNTGKVQIATFQTMVELGGNPFVPHLFKLFDSSGDGSLN
LEEFTRALEYFGQLDNEEEQYKFAFRIYDQDGDGFISSEELFNVLQTLMGAAVPDSQLEQ
VVYNTMSEFDRDGDNKLDMQEFKALLSRDDLANKFSMSM
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcaagctaacgaaaaaggatgtagagagactacaaagacgcttccagcgcctt
gccaacaacacgggcaaggtgcagatagccacattccagacgatggtggagctcggggga
aacccattcgtaccgcacctcttcaagctgttcgactcgtcaggcgacgggagcctcaac
ctggaggagtttacgcgggccctcgagtactttgggcagctggacaatgaggaggagcag
tacaagttcgcgttccgcatctacgaccaggacggtgacggcttcatctccagcgaggag
ctgttcaacgtgctgcagacgctcatgggcgcggcggtgccggactcgcagctggagcag
gtggtatacaacacgatgagcgagttcgaccgcgacggcgacaacaaactggacatgcaa
gagttcaaggcgctgctgtcgcgcgacgacctcgcaaacaaattctccatgagcatgtag

DBGET integrated database retrieval system