KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_119655Help
Entry
CHLREDRAFT_119655 CDS       T01039                                 

Definition
histone deacetylase
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
cre  Chlamydomonas reinhardtii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 311 aa AA seqDB search
PQYNISFFGIEKLHPFDAGKFAKVVKALKRDGVVLGDAQLVTPREATPEMLSDVHTADYL
HRIHNHNFTVVQVTELAALAMLPNKLLQWRVVAPMRMHVGGTMLALGLALERGWAVNIGG
GMHHASADRGMGWCPFDDIMLGAAAAGDGAGAGGLKVLVIDLDAHQGNGVERLALGDGQL
YILDMYNAGVFPRDDEAKAGIDIRVELKSGTEDDVYLNRLRAALERAALVLPRPDLVVYN
AGTDVLAGDPLGRLGVSHAGVVERDELVWRWCRDVARAPIAMLLSGGYAKDSAAVITASL
TNLINKFDLKS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
ccccagtacaacatatcattcttcggcattgagaagctgcaccccttcgacgccggcaaa
ttcgctaaggtggttaaggccctgaagagggacggcgtggtgctcggcgatgcgcagctg
gtgacgccgcgggaggccacgcccgagatgctgtctgacgtacacacggccgactacctg
caccgcatacacaaccacaacttcacggtggtgcaggtgacggagctggcggcactggcc
atgctgcccaacaagctgctgcagtggcgcgtggtggcgcccatgaggatgcatgtgggc
ggcaccatgctggccctgggtctggctctggagcgcggttgggcggtcaacattggcggc
ggcatgcaccacgcctccgccgacagaggcatgggctggtgccccttcgacgacattatg
ctgggcgctgcggctgcaggtgacggtgctggtgcaggcgggctcaaagtgttggtgatc
gacctggacgcacaccagggcaacggcgtggagcgactggccctgggtgacgggcagctg
tacatcctggacatgtacaacgccggcgtgttcccgcgtgatgacgaggccaaggccggc
atagacatccgtgtggagcttaagagcggcacggaggacgacgtctacctcaacaggctg
cgggcggcgctggagagggcggcgctggtgctgccgcggccggacctggtggtgtacaac
gccggcacggacgtgttggcaggcgacccgctggggcggctgggcgtcagccacgcgggc
gtggtggagcgagacgagctggtgtggcgctggtgtcgtgacgtggcacgggcacccatt
gccatgctgctgagtggcggctatgccaaggacagcgccgcagtcatcaccgcctcactc
accaacctaatcaacaagttcgacctgaagtcctga

DBGET integrated database retrieval system