KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_121355Help
Entry
CHLREDRAFT_121355 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CHLREDRAFT_121355
Protein kinases [BR:cre01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CHLREDRAFT_121355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 299 aa AA seqDB search
PPRPPCKADYAWMRVIGAGSFGRVSLARELEGGRLVAIKTLNKVAIIRENQVQHVLDERA
MLARVAGYPFLINLLTSFQDTDNIYLVMDYVPGGEFFTHMRDNGPLHEIHARFYVAQIIL
ALEHLHGKGIAYRDLKPENLLIGADGYVRLTDLGFAKVVTTRTYTLCGTPDYLAPEVIMN
HGHTTAVDWWSLGCVVYELLHGFPPFYTGNPQETYTRILNRSFQFPSKFGPYAVDLIDKL
LTVNPATRLGAGAEGVQAVKDHPWFTNLDWALVAAKAYQPPHVPKLAAPDDTRCFDSFE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ccccctcggccgccctgcaaggccgactacgcctggatgcgcgtgatcggggccggcagc
ttcggccgcgtcagcctggctcgcgagctggagggcggtcggttggttgcgatcaagaca
ctgaacaaggtggccatcatccgggaaaatcaggtacaacacgtgctggacgagcgcgcc
atgctggcacgtgtggcgggctaccccttcctcatcaatctgctcacctccttccaggac
accgacaacatctacctggtcatggactacgtgcccggtggcgagttcttcacgcacatg
cgcgacaacgggccgctgcacgagatacacgcccgcttctacgtggcacagatcatcttg
gctctggagcacctgcatggcaagggcatcgcctaccgggacctcaaacctgagaacctg
ctcataggcgcggacggctacgtgcggctcacagacctgggctttgcaaaggtggtcacg
acgcgcacgtacacgctgtgcggcacgcccgactacctggcgcccgaggtcatcatgaac
cacgggcacaccaccgccgtggactggtggtctctgggctgcgtggtgtacgagttgcta
cacggcttcccgcccttctacacaggcaacccgcaggagacctacacgcgcatcctgaac
cgcagcttccagttcccatccaagttcgggccctacgccgtggacctcatcgacaagctg
ctcacggtgaaccccgccacccgtctgggcgccggagccgagggcgtgcaggcggtgaag
gaccacccctggttcaccaacctggactgggcgctggtcgccgcaaaggcctaccagccg
ccgcatgtgccaaaactggcggcgcccgacgacacgcgctgcttcgacagcttcgag

  All links  
No link information was found.   
DBGET integrated database retrieval system