KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_121621Help
Entry
CHLREDRAFT_121621 CDS       T01039                                 

Definition
biquitin carboxyl-terminal hydrolase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
cre  Chlamydomonas reinhardtii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 499 aa AA seqDB search
WEIHNFAKLTQADRQTSETFEIGTYLWRMLCFPRQNATPHRHVSVFLEYPEASFTPNHLS
PKASFKLIIKNFKDPSKNFEKSADHTFESHQVDWGFSQMLPLQDLNSGYLREDGAMVIRV
EITIQRDERFTYDSRTVTGFVGLKNQGATCYMNSLLQYLYNVPLFRKAVYHMPVPENEEP
SKSLPVALQSLFYKLQYAPSAVSTKDLTASFGWNTYDAFMQHDVQELNRVLCEKLEEKMK
NTKVEKAINELFEGFTYNFIECIGVDYKSTRKESFMDLQLDVKGCKNIYDSFDKYTEVEV
LNGQNQYKTDDFGMQDARKGILFESFPPVLQLQLKRFEYDFQRDSMVKINDRYEFYDELD
LDREAGKFLSPTGAQQLSTGSLSAPRNTYKLHSVLVHSGGVHGGHYYAYIRPDGQQWLKF
DDDRVTKAEPHDALEGQYGEAGCILYRFPNHVGNPRLPRHPQCSNAYMLVYVRVADWARV
MCDVTKNDIAKHLLDRLEV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
tgggagattcacaatttcgccaagctgacacaagcggaccggcagacgtcagagacgttt
gaaatcggcacgtacctatggcgcatgctgtgctttccgcgccagaacgcgacgccgcac
cggcacgtgtcggtattcctggagtacccggaggcctccttcacgcccaaccacctcagc
ccgaaggccagcttcaaactcatcatcaaaaacttcaaagaccccagcaaaaactttgag
aagagcgcggaccacacgttcgagtcccaccaggtggactggggcttcagccagatgctg
ccgctgcaggacctcaacagcggctacctgcgcgaggacggcgccatggtgatacgggtg
gagataaccatccagcgcgatgagcgcttcacgtatgacagccgaaccgtcacgggcttc
gtgggcctcaagaaccagggcgccacgtgctacatgaactcgctgctgcagtacctgtac
aatgtgccgctgttccgaaaggccgtgtaccacatgccggtgccggagaacgaggagccc
agcaagtcgctgccggtggcgctgcagagcctgttctacaagctgcaatatgctccctcg
gccgtgtccacaaaggacctgaccgcctcgttcggctggaacacctacgacgccttcatg
cagcacgacgtgcaggagctcaaccgcgtgctgtgtgagaagctggaggagaagatgaag
aacaccaaggtggagaaggccatcaacgagctgttcgagggcttcacctacaacttcatt
gagtgcatcggcgtggactacaagtccacccgcaaggagtccttcatggacctgcagctg
gacgtcaagggctgcaaaaacatctacgactcattcgacaagtacacggaggtggaggtg
ctcaacggccagaaccagtacaagaccgacgacttcggcatgcaggacgctcgcaagggc
attctgttcgagtcgttcccgccggtgctgcagctgcagctcaagcgcttcgagtacgac
ttccagcgcgactccatggtcaagatcaacgaccgctacgagttctacgacgagctagac
ctggaccgcgaggccggcaagttcctgtcgcccaccggcgcccagcagctgtccaccggc
tccttgtcggcgccgcgcaacacctacaagctgcacagcgtgctggtgcacagcggcggc
gtgcacgggggacactactacgcctacatccggccggacggccagcagtggctcaagttc
gacgacgaccgggtcaccaaggcggagccgcacgacgcgctggaggggcagtacggtgag
gcaggctgcatcctataccgctttcccaaccatgttggcaacccccgactccctcgccac
ccgcagtgctccaacgcctacatgctggtgtacgtgcgtgtggccgactgggcccgcgtc
atgtgtgacgtgaccaagaacgacatcgccaagcacctgctcgacaggctggaggtgtga

DBGET integrated database retrieval system