KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_122203Help
Entry
CHLREDRAFT_122203 CDS       T01039                                 

Gene name
DPE1
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CHLREDRAFT_122203 (DPE1)
Enzymes [BR:cre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CHLREDRAFT_122203 (DPE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 941 aa AA seqDB search
MSQHPGISVTLHFSVAYPTQWGQCILLAGSGALLGGLEWSKARQLSCTNDKDLIVWEATI
VLPWKPSYTYKYALDDTSGPSVHGNWIIEKEDAAGERTVWLPEGLQGGELVEVVDSWVDK
SHPAALMASAAFTKVLFSHKSLVRTGGLPLDARCSPAPGETVVRLQVADFQLEDGEAVLV
TGGIPQLGNWQPDQMCQLTETHTPFWEAELRVPYSCFPFTYKYAIQTAEGLVAGRVCAVQ
RQVDVAVQSSSEVMSGVRAARGAARDRHWRGAGVAVPVFSLRSQHSVGVGEFLDLMPLVD
LADRSGMRLIQVLPVNDTCVYGTWYDSYPYSTLSVHALHPQYLALRDLLAEEGQELPHDL
AAELHKARRELDKPAVDYEATMAFKSAFGRAVYDRYGQGTLTSPAFAAWFGENAHWLRPY
AAFCFLRDIFQTAEHWRWGALSSGSDEVVDRLTRPGGEFYPRMQLTYYTQFHLHRQLLRA
SQYAAAKRVVLKGDLPIGVDKRSVDTWRAPHLFRMDKSTGAPPDAFSPTGKARGATRGRG
RGPGHGGGRNWGFPTYDWSAMSADGFAWWRSRLSHLAQYFTAYRIDHVLGFFRIWEVPGD
CVTGLLGYFRPSQPLTKSELEQRGVWDTERLVKPLITEAALKQLFGERWEVVAATYLLED
GPGKYKLRPAYSSECAIAAIPLRPDSPAWLVREVEETRAGLMRLRQNVVLLADPEDPEAF
HPRFGLMGTSSYAALPAPWRATLRHMHDDYFYRRQEDVWRTSAMSKLPALQAATDMLVCG
EDLGFVPTCVPPVMKELGLLGLRIQRMATERDKEFNNPAAYPYLTVASPSCHDVTPLRAW
WSDPERAERFYYHQLGGCGPPPPTCGPNVVRAVLQQHINCPSMLTIFPLQDLMALSSEYA
SQRPSQEEVINDPTVPKHYWRFRIHTPLEALLADCDWLATI
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcatccgggcatctcagtaactttgcacttctcggtggcatacccaacgcaa
tgggggcaatgtatcctacttgctggctcgggagcgctgctgggcggtctggagtggtca
aaagcgcggcagctttcgtgcacaaacgacaaggacctcatcgtttgggaagcgacgata
gtgctgccatggaagccttcctacacctacaaatacgctctggatgacacgagcggccct
agcgtgcacgggaactggattattgaaaaggaggacgcagctggggagcggacggtctgg
ctgcctgagggcctgcagggcggtgagctggtggaggtggtggactcgtgggtggacaag
tcgcaccccgcggccctgatggccagtgcggcattcaccaaggtcctgttctcccacaag
tcgctggtgcgcacgggcggactgccgctggacgcccgctgcagccccgcacccggggag
acggtggtgcggctgcaggttgctgacttccagctggaggacggcgaggctgtgcttgtg
acgggcggcatcccgcagctgggcaactggcagccggaccagatgtgccagctcacggag
acgcacacgcccttctgggaggcggagctgcgagtgccctactcctgcttccccttcacc
tacaagtacgccatacagaccgcggaggggctggtcgccgggcgagtttgcgcagtgcag
cggcaggtggacgtcgcagtccagagcagctccgaagtcatgtcaggagtgcgagccgcg
cgcggagccgcgcgcgaccggcactggcgcggcgcgggtgtggctgtgcctgtgttcagc
ctgcgcagccagcactcggtgggcgtgggcgagttcctggacctcatgccgctggtggac
ctggcggacaggtctggcatgcggctgatccaggtgctgccggtcaacgacacgtgtgtg
tacggcacgtggtacgactcctacccctactccaccctgtccgtacacgcgctgcacccc
cagtacctggccctgcgcgacctgcttgcggaggaggggcaggagctgccgcacgacctg
gcggcggagctgcacaaggctcggcgcgagctggacaagccggcggtggactacgaggcc
accatggccttcaagagcgccttcgggcgggctgtgtacgaccgctacggccagggcacg
ctgaccagcccggccttcgcggcctggttcggcgagaacgcgcactggctgcggccctac
gccgcgttctgcttcctcagggacatcttccagacggctgagcactggcgctggggcgcg
ctgtcctcgggcagtgacgaggtggtggaccgactcacgcgccccgggggggagttctac
ccgcgcatgcagctgacctactacacccagttccacctgcaccgccagctgctgcgagcc
tcgcaatacgccgcagccaagcgtgtggttctcaagggcgacctgcccattggtgtggac
aagcgctccgtggacacatggcgggcgccgcacctcttccgcatggacaagagcacaggc
gcgccgccggacgccttctcgccaacaggcaaggcgcggggggcgacgcgggggcggggg
cgggggccgggacacggaggcgggcgcaactggggcttccccacctacgactggtccgcc
atgtccgctgacggcttcgcctggtggcgcagccggctgtcgcacctggcgcagtatttc
acagcctaccgcattgaccacgtgctgggcttcttcaggatatgggaggtgccgggggac
tgcgtcacgggcctgctgggctacttccggcccagccagccactgaccaagtccgagctg
gagcagcgcggcgtgtgggacaccgagcgcctggtcaagccgctcatcaccgaggccgcc
ctcaagcagctgttcggcgagcggtgggaggtggtggcggccacctacctactggaggac
ggacccggcaagtacaagctgcggccggcctactccagcgagtgcgccattgcggccatc
ccgctgcggcccgactcgccggcctggctggtgcgggaggtggaggagacgcgggcgggg
ctgatgcggctgcggcagaatgtggtgctgctggcagaccccgaggacccggaggcgttc
cacccccggttcgggctgatgggcaccagcagctacgccgcgctgccggccccctggcgc
gccacgctgcggcacatgcacgatgactacttctacaggcggcaggaggacgtgtggcgg
acgtcggccatgtccaaactgcccgcactgcaggccgccacggacatgctggtgtgcggc
gaggacctcgggttcgtgccgacctgcgtgccgcccgtcatgaaggagctgggcctgctg
ggccttcgcatccagcgcatggccaccgagcgcgacaaggagttcaacaaccccgccgcc
tacccctacctcacagtggccagcccctcatgccacgacgtcacgcccctgcgcgcctgg
tggtccgacccggagcgcgccgagcgcttctactaccaccagctgggcggctgcggcccg
ccgccgcccacctgcggccccaacgtggtgcgggcggtgctgcagcagcacatcaactgc
ccctccatgctcaccatattcccgctgcaggacctgatggccctgtcctccgagtacgcc
tcccagcggcccagccaagaggaggtcatcaacgaccccaccgtgcccaagcactactgg
cgcttccgcatacacacgccgctggaggcgctgctggccgactgcgactggttggccacc
atc

  All links  
No link information was found.   
DBGET integrated database retrieval system