KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_123644Help
Entry
CHLREDRAFT_123644 CDS       T01039                                 

Gene name
HTB23
Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
cre  Chlamydomonas reinhardtii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 153 aa AA seqDB search
MAPKKDEKPVTAEAGAEAPAKAEAKPKAEKAAKKAKKEPSKKAAKEPKGDGEKKDKKKKK
SAVETYKLYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEKVATEASKLSRYNKKPTVTS
REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcccccaagaaggacgagaagcccgtgaccgccgaggctggcgccgaggcccctgcc
aaggctgaggccaagcccaaggccgagaaggccgccaagaaggccaagaaggagccctcc
aagaaggctgctaaggagcccaagggcgatggcgagaagaaggacaagaagaagaagaag
agcgctgtggagacctacaagctgtacatctacaaggtgctcaagcaggtgcaccccgac
accggcatcagcagcaaggccatgtccatcatgaacagcttcatcaacgacatctttgag
aaggtggccaccgaggcctccaagctgagtcgctacaacaagaagcccactgtgacctcc
cgcgagatccagaccgccgtgcgcctggtgctgcccggcgagctggccaagcacgcggtg
tcggagggcaccaaggccgtgactaagttcacctcaggctaa

DBGET integrated database retrieval system