KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_126232Help
Entry
CHLREDRAFT_126232 CDS       T01039                                 

Gene name
HDH1
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cre01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cre00340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 462 aa AA seqDB search
MLAGKLRAPASKQACPTQRLATPRISSRCARQQRLQVNAVAMEAPSTLRTYQYSKLNPAE
LKQVLARPRIDFTSILNTVSPIVENVRANGDAAVREYTAKFDRVNLDSVCVPIEDIPDPV
LPAEVTHAFDVAYNNIRAFHTAQQSAPMEVETMPGVKCRRVTRPINAVGVYVPGGTAVLP
SSALMLAVPAGIAGCGTIVLATPPRPDGTITPEVLYCAKKAGVTHILKAGGAQAVDKILG
PGNQYVTAAKMLLQNSEAMVAIDMPAGPSEVLVIADAGASPVHVAADLLSQAEHGPDSQV
VLVALPGVDLAAVSAEVDRQCNALPRNETARKALGHSYVVQVASRAEAIRFSNMYAPEHL
IVNVEDAEDWLSELDNAGSVFLGRWTPESVGDYASGTNHVLPTYGYARMYSGVSLDSFTK
KMTVQNLTYEGLQNLGPSVAKMAEIEGLDAHRRAVTLRLGMQ
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctggcaagctccgggccccagcttccaagcaggcctgccccactcagcgtctt
gctactccccgcatttccagccgctgtgcccgccagcagcgactgcaagtgaacgctgtc
gccatggaggccccgtctacgttgcgcacctaccaatacagcaagcttaacccagcggag
ctgaagcaggttctggctcgtcctcgtattgatttcacctcaatcctaaacactgtctcg
cctatcgtggagaacgttcgcgcaaacggcgatgcggccgtgcgcgagtatacggcaaag
ttcgaccgtgtgaacctggactccgtgtgcgtgcccatcgaggacatccctgacccggtg
ctgcctgccgaggtgacccatgccttcgacgtggcgtacaacaacatccgtgccttccac
acggcgcagcagtccgcgcccatggaggtggagaccatgccgggcgtcaagtgcaggcgt
gtgacccgccccatcaacgctgtgggcgtgtacgtgcccggtggcacagcggtgctgccc
agctcggcgctcatgctggcagtgcccgctggcatcgcgggctgcggcaccatcgtgttg
gccacgccgccccgccccgacggcaccattacgcccgaggtgctgtactgcgccaagaag
gcgggtgtgacccacatcctcaaggccggcggcgcgcaggcggttgacaagatcctgggt
cccggcaaccagtacgtgacggccgccaagatgctgctgcagaactctgaggccatggtg
gccatcgacatgccggccggccccagcgaggtgctggtcatcgcggacgccggcgccagc
cccgtgcacgtggccgccgacctgctcagccaggccgagcacggccccgacagccaggtg
gtcctggtggcgctgccgggtgtggacctggcggcggtgtcggccgaggtggaccgccag
tgcaacgccctgccgcgcaacgagacggcgcgcaaggcgctgggccactcgtatgtggtg
caggtggcgtcgcgggccgaggccatccgcttcagcaacatgtacgcgccggagcacctg
atcgtcaacgtggaggacgccgaggactggctcagcgagctggacaacgcgggctctgtg
ttcctgggccgctggacgcccgagtcggtgggcgactacgccagcggcaccaaccacgtg
ctgcccacctacggctacgcgcgcatgtactcgggcgtcagcctggacagcttcacgaag
aagatgactgtgcagaacctgacgtacgagggtcttcagaacctgggccccagcgtggcc
aagatggcggagatcgaggggctggacgcgcaccgccgcgcagtcaccctgcgtttgggc
atgcagtag

DBGET integrated database retrieval system