KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_126990Help
Entry
CHLREDRAFT_126990 CDS       T01039                                 

Definition
hypothetical protein
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CHLREDRAFT_126990
Peptidases [BR:cre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CHLREDRAFT_126990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 350 aa AA seqDB search
MGANSSKLEKALAEAPEDERYYGLENFGNTCYCNSVLQALYFCKPFRERLLKYGASLPGN
VEENLLNCLADLFTQINSSKKKVGVISPKKFVQRLKRDNELFRGHMHQDAHEFLNYLLNC
SCELLEQEAKAAGGGGGGGGGSSQPITTWVHDIFQGKLVNETRCLHCETVTSREEVFMDL
SLEIDQNTSVTSCLRNFSSMEMLDRDDKFFCDHCCCLQEAKKRMLLRSVPPCLILHLKRF
KYVEAQGRMRKLMYRVVFPMELKLANTTSDDPAAPDTLYSLTAVVVHVGSGPHHGHYVSL
IKSGSQWMFFDDETVELITESQVQSTFGSTSDYGQNNMDHGYILFYEKAG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccaatagcagcaagctagaaaaggcgctcgcggaggccccggaggatgagcga
tactatggtcttgaaaactttggcaacacgtgctattgcaactccgtgttgcaagcactg
tacttctgcaaaccgtttcgcgagcggctgctgaagtatggcgcgtcattgccgggtaac
gtcgaggagaatctgctgaactgcctggcggacctcttcacacagatcaactcgagcaag
aaaaaggtgggcgtaatctcgcccaagaagtttgtgcagcggctgaaacgcgacaacgag
ctgtttcgggggcacatgcaccaggacgcgcacgagttcctgaactacctgctcaactgc
agctgcgagctgctggagcaggaggccaaggcggcgggcggagggggaggcggaggcggc
ggcagctcgcagcccatcactacctgggtgcacgacatcttccagggcaagctggtgaac
gagacccgctgcctgcactgcgagacggtcaccagccgcgaggaggtattcatggacctc
agcttggagatcgaccagaacacctccgtcacatcctgcctgcgcaacttcagctccatg
gagatgctggaccgggacgacaagttcttctgcgaccactgctgctgcctgcaggaggcc
aagaagcgcatgctgctgcgctccgtgccgccctgcctcatcctgcacctcaagcggttc
aagtacgtggaggcgcagggcaggatgcgcaagctgatgtaccgggtggtgttccccatg
gagctcaagctggccaacaccacctcggacgaccccgcggcgcccgacacgctgtacagc
ctgaccgcagtggtggtgcacgtgggcagcgggccgcaccacggtcactacgtctccctc
atcaagagcggcagccagtggatgttctttgacgatgagacggtggagctgatcacagag
agccaggtgcagagcacgtttgggtccacgtccgactacggccagaataacatggaccac
ggatacatcctgttctacgagaaggcagggtga

DBGET integrated database retrieval system