KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_127384Help
Entry
CHLREDRAFT_127384 CDS       T01039                                 

Gene name
THS1
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CHLREDRAFT_127384 (THS1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHLREDRAFT_127384 (THS1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CHLREDRAFT_127384 (THS1)
Enzymes [BR:cre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CHLREDRAFT_127384 (THS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 498 aa AA seqDB search
MQVQQKLGASRAMKASRNVQRVFAAHSDIRKEAALRVPLDKAHTFNAKFVPFADVQSNKM
SPETYSLDDIVYRSRDGGLLDVHHDMKALAQYGPDYWRALFDARVGTTAWPFGSGVWSKK
EWVLPGLSDDDIVSMFEGNSNLFWAERFGREALGMTDLWVKQCGNSHTGSFKDLGMTVLV
SQVNRIRKLKPGSITAVGCASTGDTSAALSAYCAAAGIPSIVFLPADKISLAQLVQPIAN
GALVLSIDTDFDGCMRLIKQVTAETPIYLANSMNSLRLEGQKTAAIEILQQFDWQVPDWV
IIPGGNLGNIYAFYKGFKMCKELGLVDKMPRLVCAQAQNANPLYQAFSKAQGSNAAIKES
YEPMKAKMTFASAIQIGDPVSIDRAIMALKDTNGIVEEASEEELMDAAARADRTGMFNCP
HTGVALAALTKLRERQVIGPNDRTVVVSTAHGLKFTQSKVAYHSKQVPGMTCQFANPPVQ
VREDLGAVMDAIKTKFKL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgcagcagaagctaggcgcctcccgggccatgaaggccagccgcaacgtccag
cgtgtatttgcggcgcactcggacattcgcaaggaggctgcgctgcgtgtgcccctggac
aaggcgcataccttcaacgccaagttcgttcccttcgcggatgttcaaagcaacaagatg
tccccagagacttactccctggacgacatcgtctaccgatcgcgggacggcggcctgctg
gacgtgcaccatgacatgaaggccctggcacagtatggcccagactactggcgtgcgctg
tttgatgctcgcgtgggcacgaccgcttggccctttggctcgggcgtgtggagcaagaag
gagtgggttctgccgggcctgtcggacgacgacattgtgtccatgtttgagggcaacagc
aacctgttctgggcggagcgcttcggccgggaggcactgggcatgaccgacctgtgggtg
aagcagtgcggcaacagccacacgggctctttcaaggacctgggcatgaccgtgctggtc
tctcaggtgaaccgcatccgcaagctgaagcccggcagcatcactgccgtgggctgcgcc
tccaccggcgacacctctgccgccctgtccgcctactgcgcggccgccggcatcccctcc
atcgtgttcctgcccgcggacaagatttcgctggcgcagctggtgcagcccatcgccaac
ggtgcgctggtgctgtccatcgacaccgacttcgacggctgcatgcgcctaatcaagcag
gtgaccgccgagacgcccatctacctcgccaacagcatgaactcgctgcgcctggagggc
cagaagaccgccgccatcgagatcctgcagcagttcgactggcaggtgcccgactgggtc
atcatccccggcggcaacctgggcaacatctacgccttttacaagggcttcaagatgtgc
aaggagctgggcctggtggacaagatgccgcgcctggtgtgcgcgcaggcgcagaacgcc
aacccgctgtaccaggccttctccaaggcccagggctccaacgccgccatcaaggagtcg
tacgagcccatgaaggccaagatgaccttcgccagcgccatccagatcggcgaccccgtg
tccatcgaccgcgccatcatggcgctcaaggacacgaacggcatcgtggaggaggccagc
gaggaggagctgatggacgccgccgcgcgcgctgaccgcaccggcatgttcaactgccca
cacaccggcgtggcgctggcggcgctcaccaagctgcgggaacgccaggtcatcggcccc
aacgaccgcacggtcgtggtgtcgacggcgcacgggctgaagttcacgcagagcaaggtg
gcgtaccacagcaagcaggtgccgggcatgacatgccagttcgccaacccgccggtgcag
gtccgcgaggacctgggcgctgtgatggacgccatcaagaccaagttcaagctctag

DBGET integrated database retrieval system